KEGG   Bos mutus (wild yak): 102267885Help
Entry
102267885         CDS       T02919                                 

Definition
(RefSeq) steroid 21-hydroxylase-like
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
bom  Bos mutus (wild yak)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102267885
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    102267885
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     102267885
Cytochrome P450 [BR:bom00199]
 Cytochrome P450, animal type
  CYP21 family
   102267885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 308 aa AA seqDB search
MVLAGLLLLLTLLAGAHLLWGRWKLRNLHLPPLVPGFLHLLQSNLPIHLLSLTRMRVQAG
APVTTQKEFSLLTCSIICYLTFGNKEDTLVHAFHDCVQDLMKTWDHWSIQILDMVPFLRF
FPNPGLWRLKQAIENRDHMVEKQLTRHKESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLL
EGHVHMSVVDLFIGGTETTASTLSWAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYK
DRARLPLLNATIAEVLRLRPVVPLALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETV
WEQPHDAQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcgcagggctgctgctgctgctcaccctgctagctggcgctcacctgctatgg
ggccggtggaagctcagaaacctccacctcccacctctggtccccggcttcctgcacctg
ctgcagtccaacctccccattcatctgctcagcctgactcgcatgagagtccaggccggt
gctcccgtgaccacccagaaggaattctctctgcttacctgcagcatcatctgttacctc
acttttggaaacaaggaggacaccttagtacatgcctttcacgactgtgttcaggacttg
atgaagacctgggaccactggtccatccagattttggacatggttccttttctcaggttc
ttccccaaccctgggctctggaggctgaagcaggccatagagaacagggaccacatggtg
gagaagcagctgacgcgccacaaggagagcatggtggccggccagtggagggatatgacg
gactacatgctccagggggtagggaggcaaagagtagaagagggcccgggacagctcctg
gaaggacacgtgcacatgtctgtggtggaccttttcatcgggggcactgaaaccacggcg
agcaccctctcctgggctgtggcgttcctacttcaccaccccgagattcagcgccgcctt
caggaggagttggatcgcgagctgggccccggagcctcatgctcccgagtcacttacaag
gaccgcgctcggctgcctctgctcaacgccaccatcgcggaggtgctgcgcctgcggccg
gtcgtgcccctggccttgcctcaccgcaccacgcggcctagcagcatcttcggctacgac
atccctgagggcatggtcgttatccccaacctccaaggtgcccacctggacgagaccgtc
tgggagcagccgcacgatgcccagtga

DBGET integrated database retrieval system