KEGG   Bos mutus (wild yak): 102268029Help
Entry
102268029         CDS       T02919                                 

Gene name
CHKA
Definition
choline kinase alpha
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
bom  Bos mutus (wild yak)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bom00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 373 aa AA seqDB search
LRTRRRAYLWCKEFLPGAWRGLREDQFHISVIRGGLSNMLFQCSLPDTLATVGDEPRKVL
LRLYGAILKMRSCNKEGSEQAQKDSEFQGAEAMVLESVMFAILAERSLGPKLFGIFPQGR
LEQFIPSRRLDTEELSLPDISAEIAEKMARFHGMKMPFNKEPKWLFGTMEKYLNQVLRIR
FTGESKVKQLHRFLSYNLPLELENLRSLLESTPSPVVFCHNDCQEGNILLLDGRENSEKQ
KLMLIDFEYSSYNYRGFDIGNHFCEWMYDYNYEKYPFFRANILKYPTRKQQLHFISNYLA
AFQNEFENLSNEEKSVIEEEMLLEVNRFALASHFFWGLWSIVQAKISSIEFGYMEYAQAR
FDAYFDQKRKLGV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ctccggacgcggcgcagggcctatctgtggtgcaaggagttcctgcccggcgcctggcgg
ggccttcgcgaggaccagttccacatcagtgtcatcagaggtggcctcagcaacatgctg
ttccagtgctccttgcccgacaccctggccaccgtcggagacgagcctcggaaggtgctc
ctgcggctgtacggggcgatcctgaagatgcggtcctgtaataaggagggatccgaacaa
gctcagaaagacagtgaatttcaaggcgccgaggccatggtcctggagagcgtcatgttt
gccattctcgccgagaggtcgctggggccgaagctctttggcatcttcccccaaggccgc
ctggagcagttcatcccgagccggcgattagacactgaagaattaagtttgccagatatt
tctgcagaaatagctgagaaaatggccagatttcatggtatgaaaatgccattcaataag
gaaccaaaatggctctttggaacaatggaaaaatacctgaatcaagtgctgagaattagg
tttaccggggagtccaaagtgaagcagctgcacaggttcctcagttacaacctgcctttg
gagctagaaaacctgaggtcattgcttgaatccactccatctcccgtcgtgttctgtcac
aatgactgtcaggaaggtaacatcttactgctggatggcagggagaattcggaaaaacag
aaactcatgctcatcgactttgaatacagcagttacaactataggggattcgacattggg
aatcatttctgtgaatggatgtatgattataattatgaaaagtacccttttttcagagca
aacatcctgaagtaccccaccaggaaacaacagctccattttatttccaattacttggct
gcattccaaaatgaatttgaaaacctcagtaacgaagaaaagtctgttatagaagaagaa
atgctgcttgaagtcaataggtttgccctcgcgtcccatttcttctggggactctggtca
atcgttcaggccaagatttcctccattgaatttgggtacatggagtacgcccaagccagg
tttgatgcctacttcgaccagaagaggaagctcggggtgtga

DBGET integrated database retrieval system