KEGG   Bos mutus (wild yak): 102268363Help
Entry
102268363         CDS       T02919                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bom  Bos mutus (wild yak)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102268363
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     102268363
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102268363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 349 aa AA seqDB search
MVKRQEEGGSHYKRISGENFSGDYHEYFGLQVDEDALTYIMLANHLVHTLYPDSITIAED
VSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEYKDEDWNMGNIVYTLTNRRYLEKC
IAYAESHDQALVGDKTLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHALGGE
GYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLADDDLLRYKFLNNFDRDMNKLEER
CGWLSAPQAHVSEKHEDNKIIAFERASLLFIFNFHPSKSYTDYRVGTTLPGKYKIVLDSD
AAEYGGHKRLDHNTEFFSEPFEHNNCPCSLLVYIPNRVALILRNVDLPN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaggcaggaggaaggtggatctcattataaaaggatatcaggtgagaatttt
tcaggtgattaccatgagtattttggactacaagtagatgaagatgctttgacttacatc
atgttggcaaatcatttggttcacacactgtatccagattctataacaatagctgaggat
gtatccggaatgccagctctgtgttctccaatttcccagggagggggtggttttgactat
cgattggctatggcaattccagataaatggatccagttactgaaagaatataaagatgaa
gattggaacatgggcaatatagtgtatacactcacaaaccgacgctaccttgaaaagtgc
attgcctacgcagagagccacgatcaggcacttgttggggataagacgttggcattttgg
ttgatggatgctgaaatgtataccaacatgagtgttctgaccccatttactcccgttatt
gatcgtggaatacagcttcacaagatgattcgactcattactcacgcactcggtggagag
gggtatctcaatttcatgggtaatgaatttgggcatcctgaatggttagacttcccaaga
aaaggaaataatgagagctaccattatgcacgaaggcagtttcatttagctgatgatgac
cttcttcgctataagttcctaaataactttgacagggatatgaataaattggaagaaaga
tgtggttggctttcagctccacaggcccatgtgagtgaaaagcatgaagacaataagatc
attgcttttgagagagctagtcttcttttcatcttcaactttcatccaagcaagagctat
actgattaccgagttggaacaacattgccaggaaagtacaaaattgtgctcgattcagat
gcagcagaatacggaggacacaagagactggaccacaataccgaattcttctctgaacct
tttgaacataataactgtccctgttctcttttggtgtacattccaaaccgagtggccctc
atccttcgcaatgtggacctgcccaactga

DBGET integrated database retrieval system