KEGG   Bos mutus (wild yak): 102268554Help
Entry
102268554         CDS       T02919                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102268554 (ABHD12)
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102268554 (ABHD12)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102268554 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 405 aa AA seqDB search
MFPNTICGVDDVMKRWCVMKRWCFLSNEDYQKPLLTFFQLSRGPWSKFEDLWAREGFETW
PEASRAGASGRRKGLCFRLRKILFFVLGLYVAIPFLIKLCPGIQAKLIFLNFVRVPYFID
LKRPQDQGLNHTCNYYLQPEEDVTIGVWHTVPTVWWKNAQGKDQMWYEDALSSSHPIILY
LHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKV
RSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRY
FPGFDWFFLDPITSSGIQFANDENVKHISCSLLILHAEDDPVVPFQLGRKLYNIAAPSRS
FRDFKVQFIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPGRQH
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctaacaccatctgtggagttgatgatgtcatgaagcgatggtgcgtcatgaag
cgatggtgcttcctgagcaacgaagactaccagaagcccctgctgaccttttttcagttg
tcgagaggcccatggtccaagtttgaggatctctgggctagagagggttttgagacctgg
cctgaggcttccagagcaggggcctccggaaggcgaaagggcctgtgcttccgactgagg
aagatactcttctttgtcctgggattgtacgtggccattccatttctcatcaaactatgt
cctgggatacaggccaaactgattttcttgaatttcgtgcgggttccctatttcattgat
ttgaaaagaccacaggatcaaggtttgaatcacacctgtaattactacctccagccagag
gaagacgtaaccattggagtctggcacacggtccccactgtctggtggaagaatgcccag
gggaaggaccagatgtggtacgaggatgccctgtcttccagccacccaatcatcctgtac
ctgcatgggaacgcgggcaccagaggcggcgaccaccgggtggagctttacaaggtgctg
agttccctcggctaccacgtggtcacctttgactacagaggttggggtgactcagtagga
acgccatcggagcggggcatgacgtatgatgcactccatgtttttgactggatcaaagtg
cgaagtggagacaaccctgtgtatatttggggccattctcttggcaccggagtggccaca
aacctggtgcggcgcctctgtgagcgagagactcctccagatgccctcatcttggaatct
ccattcactaatatccgtgaagaagccaagagccatccgttctcagtgatctatcgatat
ttccctgggtttgactggttcttccttgatcccatcacaagcagtggaattcagtttgca
aatgatgaaaatgtgaagcacatctcctgctccctgctcatcctgcacgccgaggacgac
ccggtcgtgcccttccagctcggcagaaagctctacaacatcgccgcaccgtcacgcagc
ttccgggactttaaggttcagttcatccccttccactcggaccttggctataggcacaag
tacatctacaagagccccgagctcccgcggatcctgagggaattcctggggaagtcggaa
ccgggacgccagcactga

DBGET integrated database retrieval system