KEGG   Bos mutus (wild yak): 102270729Help
Entry
102270729         CDS       T02919                                 

Gene name
AGL
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
bom  Bos mutus (wild yak)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102270729 (AGL)
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     102270729 (AGL)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     102270729 (AGL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1532 aa AA seqDB search
MGHSKQIRILLLNEMEKLERTLFRLEQGFELQFRLGPTLQGKAVTVYTNYPLPGEAFNRE
KFRSLEWENPTEREDDSDKYCKLNLQQAGSFQYYFLQGNEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLAKCMGPFDEWESRLMVAKESGYNMIHFTPLQTLGLSRSCYSLADQLE
LNPDFSRPNKKYTWTDVGQLVQKLKKEWNMLCITDVVYNHTAANSRWLQEHPESAYNLVN
SPHLKPAWVLDRALWHLSCDVAEGKYKDRGVPALIENDHQMNCIRKVIWEDIFPKTQLWE
FFQVDVHKAVEQFRGLLTQENRKTTRPDPDHHLKIIQDPEYRRLGCTVDMNVALATFIPH
DNGPAAINECCNWFRKRIEELNSEKHQLINYHQEQAVNCLLGNVFYERLADHGPKLGPVT
RKHPLVTRYFTFPFEDISLSVEESMIHVPNKACFLMAHNGWVMGDDPLRNFAEPGSDVYL
RRELICWGDSVKLRYGKKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYML
DAARKLQPNLYVVAELFTGSEDLDNVFVTRLGISSLIREAMSAYDSHEEGRLVYRYGGEP
VGSFVQPCLRPLVPAIAHALFMDITHDNECPIVHRSAYDALPSTTIVSMACCASGSTKGY
DELVPHQISVVSEERFYTKWNPAASPSNAGEVNSQSGIIAARCAINKLHQELGAKGFIQV
YVDQVDADIVAVTRHSPSIHQSVVSVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEAR
TVERNTAPYRKDANSINGIPNITVEIREHIQLNESKIVKQAGVTTKGPNEYIQEIEFENL
SPGSVIIFRVSLDPHAQVAVGILRNHLTQFSPHFKSGSLAVDNADPILTIPFASIASRLT
LAELNQVLYRCESEEKEDGGGCYNIPNWLPLKYAGLQGLMSVLAEIRPKNDLGHPFCDNL
RSGDWMIDYVSNRLISRSGTIAEVGKWLQAMFFYLKQIPRYLIPCYFDAILIGAYTTLLD
VAWKQMSSFVQNGSTFVKHLSLGSVQMCGVGRFSSLPLLSPSLTDVPCRLNEITREKEQC
CVSLAAGLPHFSAGIFRCWGRDTFIALRGLLLITGRYLEARNIILAFASTLRHGLIPNLL
GEGTHARYNCRDAVWWWLQCIQDYCKMVPNGLDILNCPVSRMYPADDSVPLSAGTVDQPL
FEVIQEAIQRHMQGIQFRERNAGPQIDRNMKDEGFNITAGVDEETGFVYGGNRFNCGTWM
DKMGESDRARNKGIPATPRDGSAVEIVGLSKSAVRWLLELSQKNIFPYHYVTVKRHGKLV
RVSYDEWNRKIQENFEKLFYVSEDPSDVNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPN
FTIAMVVAPELFTTQKAWKALEIAEKKLLGPLGMKTLDPDDMVYCGTYDNALDNDNYNLA
KGFNYHQGPEWLWPVGYFLRAKLYFSRLMGPETTAKTIFLVKNVLSRHYVHLERSPWKGL
PELTNENGQYCPFSCETQAWSIAAVLEILYDL
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atgggacacagtaaacagattaggattttactactgaacgaaatggaaaagctggaaagg
accctcttcagacttgaacaagggtttgaactgcagttccgattgggcccaactttacag
ggaaaggcagttactgtgtatacaaattacccacttcctggagaagcatttaatcgagaa
aaattccgttccctggaatgggaaaatccaacagaaagagaagatgattctgataaatac
tgtaaacttaatcttcaacaagctggatcatttcagtattacttccttcaaggaaatgag
aaaagtggtggaggttacatagtcgtggaccctattttgcgtgttggtgctgataatcac
gtgttacccttggactgtgttacgctccagacatttttagccaagtgtatgggacctttt
gatgaatgggaaagcagacttatggttgcaaaagaatcaggctacaacatgattcatttt
accccactgcagactcttggactatccaggtcgtgctattcccttgctgatcagttagaa
ttaaatcctgacttttcaagacctaataaaaagtacacctggactgatgttggacagctg
gtgcaaaaattgaaaaaggaatggaatatgctttgtataactgatgttgtctacaatcat
actgctgctaatagtagatggctccaggaacatccagaaagtgcatataaccttgtgaat
tccccacacttaaaacctgcctgggtgttagacagagcactttggcacttatcctgtgat
gttgcagaagggaaatacaaagacagaggagtacctgctttgatcgaaaatgaccatcaa
atgaattgcattcgaaaagtaatttgggaggatatttttccaaagactcaactctgggaa
tttttccaagtagatgttcacaaagcagtcgagcaatttagaggacttcttacacaagaa
aataggaaaacaacaaggcctgatccagatcaccaccttaagataattcaggatcctgaa
tacagacggcttggctgcactgtagatatgaatgttgctctagcaactttcataccacat
gacaatgggccagccgcaattaatgaatgctgcaattggttcaggaagagaattgaggaa
ttaaattcggagaagcatcaactcattaactatcatcaggaacaggcagtcaattgcctt
ttgggaaatgtgttttatgaacgactggctgaccatggacctaaactaggacctgttact
agaaaacatcctttggttaccagatattttactttcccctttgaagacatatccctctct
gtagaagaatcaatgattcatgtcccaaataaagcttgttttctgatggcacataatgga
tgggtaatgggagatgatccccttcgaaattttgctgaaccaggttcagatgtttatcta
aggagagaacttatttgctggggagacagtgttaaattacgctatgggaaaaaaccagag
gactgtccttatctctgggcacacatgaaaaaatacacagaaatcaccgcaacttatttc
cagggagtccgtcttgataattgtcactcaacacctcttcatgtagcagagtatatgttg
gatgctgctaggaaattgcaacccaatttatatgtagtagctgaactgttcacaggaagt
gaagacctggacaatgtctttgttactagactgggcattagttccttaataagagaggca
atgagtgcatacgatagccatgaagagggcagattagtttaccgatacggaggagagcct
gttggatcctttgttcagccctgtttgaggcctttagtgccagctattgcacatgccctg
tttatggacatcacccatgataacgagtgtcctattgtgcataggtcagcatatgacgct
ctcccaagtaccacaattgtctccatggcatgttgtgctagtggtagtacgaaaggctat
gacgaattagtgcctcaccagatttcagtagtttctgaagagcggttttacactaaatgg
aatcctgcagcatcgccatccaacgctggtgaagtgaactcccagagtggcattattgcg
gccaggtgtgcaatcaataaacttcaccaagagcttggagccaagggttttatccaggtg
tatgtggatcaagttgatgcagacatagtggctgtaaccagacattcacccagtatccat
cagtcggtcgtatctgtttctagaactgctttcaggaatcccaagacttcattttacagc
aaggaagtgcctcaaatgtgcatccctggcaaaattgaagaagtagttcttgaagctaga
actgttgagagaaatacagcaccttataggaaggatgctaattcaatcaatggaatacca
aacatcacagtagaaattagagaacatattcagctcaatgaaagtaaaattgttaagcaa
gctggagttactacaaaaggacccaatgaatatattcaagaaatagaatttgaaaatttg
tctccaggaagtgttattatattcagagttagtcttgatccacatgcgcaagttgctgtt
ggaattcttcgaaatcatctgacacagttcagtcctcactttaaatctgggagtcttgct
gttgacaatgcagatcctatattaacaattccttttgcttctattgcctctagattaact
ttggctgagctaaatcaggtactttaccgatgtgaatcagaagaaaaagaagatggtgga
ggatgttataacataccaaactggttacctcttaaatatgcaggtcttcaaggattaatg
tccgtattggcagaaataagaccaaagaatgacttggggcatcccttctgtgataatttg
agatctggagactggatgattgactatgtcagtaaccgacttatttcacggtcaggaact
attgctgaagttggtaaatggttgcaggctatgttcttctacctgaagcagatcccacgt
taccttatcccgtgttactttgatgctatattaatcggtgcatacaccactcttctggat
gtagcatggaagcaaatgtcaagctttgttcagaatggttctacctttgtgaaacacctt
tccttgggttcagtccaaatgtgtggagtaggaagattctcttctctgccacttctttca
ccttcgcttacggatgtgccatgcaggctgaatgagatcacaagggagaaggagcagtgt
tgtgtgtctctagctgcaggcttacctcacttctctgctggtattttccgctgctgggga
agggatacttttattgcccttagaggtctactgctgattactggacgctatttggaggcc
aggaatatcattttagcatttgctagtaccctgagacatggcctcattcctaatctcctg
ggtgaaggaactcacgccagatacaactgccgggatgctgtgtggtggtggctgcagtgt
attcaggactattgtaaaatggttccaaatggtctggacattctcaactgcccagtttcc
agaatgtatcctgcagatgactctgttcctttgtctgccggcacagtggatcaaccattg
tttgaagtaatacaggaagctatccaaagacacatgcagggcatacagttccgagaaagg
aatgctggtccacagatagatcggaacatgaaggatgaaggttttaatattactgcaggg
gttgatgaagaaacaggatttgtttatggaggaaatcgcttcaattgcggtacctggatg
gataaaatgggagaaagtgacagagctagaaacaaaggaatcccagccactccaagagat
ggatctgctgtggaaattgtgggcctgagtaaatctgctgttcgttggttgctggaatta
tcccaaaaaaatatttttccttatcattatgttacagtgaaacgacatggaaagctggtg
agagtctcatatgatgaatggaacagaaaaatacaagagaactttgaaaagttattttat
gtgtcagaagacccttcagatgtcaatgaaaagcatcctaacctggtgcacaagcggggc
atatacaaagacagctatggagcatcaagcccttggtgtgactaccagctcaggcctaat
tttaccatagcaatggttgtggcccctgagctctttactacccaaaaagcatggaaggcc
ttggagattgcagaaaaaaaattgcttggtcctcttggcatgaaaactttggatccagat
gatatggtttactgtggaacttatgacaatgccttagacaacgacaactataatcttgct
aaaggtttcaattaccaccaaggacctgagtggttgtggcctgttgggtattttcttcgt
gcaaaattgtacttttccagattgatgggtccagagactactgcaaaaactatatttttg
gttaaaaatgtcctttctcgacattatgttcatcttgagagatccccttggaaaggactt
ccagagctgaccaacgagaatggccaatactgccctttcagctgtgaaacacaagcctgg
tcaattgctgctgttcttgaaatactctatgacttatag

DBGET integrated database retrieval system