KEGG   Bos mutus (wild yak): 102270811Help
Entry
102270811         CDS       T02919                                 

Gene name
GAD1
Definition
glutamate decarboxylase 1 (brain, 67kDa)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
bom  Bos mutus (wild yak)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Type I diabetes mellitus
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bom00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bom00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bom00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:bom00430]
Organismal Systems; Nervous system; GABAergic synapse [PATH:bom04727]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:bom04940]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDKDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARFKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLETKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSQKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaacgcgggagcggaccccaat
actaccaacctgcgccccacaacgtatgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctgaagatctgcggcttcttgcagaggaccaacagcctggaagagaag
agcaggcttgtgagcgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagtgacaaggatggccgcttccgccgcacagagacagacttctccaacctgttcgcc
cgagatctgcttccggctaagaacggggaggagcaaactgtgcaattcctgttggaggtg
gtggacatactcctcaactatgtccggaagacgttcgatcgctccaccaaagtgctggac
ttccaccacccccaccagctgctggaaggcatggagggcttcaacttggaactctctgac
caccccgagtccctggagcagatcctggttgactgcagagacaccctgaaatatggggtc
cgcacaggtcatccacgatttttcaaccagctctccacaggattggatatcattggttta
gctggcgagtggctgacatcaactgccaataccaatatgtttacatacgaaattgcacca
gtgtttgtcctcatggagcaaattacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgcttcaagtacttcccggaagttaagaccaagggtatggcggctgtgccc
aagcttgtcctcttcacctcagaacacagtcactattccataaagaaagctggggctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagagacaaaaattcttgaagccaagcaaaagggttacgtccctctctac
gtcaatgcaactgctggcaccactgtttatggcgcttttgatccgatacaggagattgca
gatatatgtgagaaatacaacctttggctgcatgtcgatgctgcctggggtggcgggctg
ctcatgtcccagaagcaccgccataagctcagtggcatcgagagggccaactctgtcacc
tggaaccctcacaagatgatgggtgtgctgctgcagtgctctgccattcttgtaaaagaa
aagggtatcctccaaggatgcaaccagatgtgtgcgggatacctcttccagccggacaag
cagtatgatgtctcctatgacactggggacaaggccattcagtgcggccgccacgtagac
atcttcaagttctggctgatgtggaaagcaaagggtacagtgggctttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggtttttgatggtgagcctgagcatacgaacgtctgtttctggtatattccacaa
agcctcaggggtgttccagatagccccgaacgacgggaaaagctacacagggtggcccca
aagatcaaagccctgatgatggaatctggcacaaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctccaacccagccgctacccaatctgatatt
gacttcctcattgaggagatagagaggctgggccaggatctgtaa

DBGET integrated database retrieval system