KEGG   Bos mutus (wild yak): 102272943Help
Entry
102272943         CDS       T02919                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
bom  Bos mutus (wild yak)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102272943 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102272943 (GYS2)
   04152 AMPK signaling pathway
    102272943 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102272943 (GYS2)
   04922 Glucagon signaling pathway
    102272943 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102272943 (GYS2)
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102272943 (GYS2)
Glycosyltransferases [BR:bom01003]
 Polysaccharide
  Storage polysaccharide
   102272943 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 673 aa AA seqDB search
MLRGRSLSVTSLGGLPRWEAGLPVENLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWGD
NYFLIGPYFEHNMKTQVEQCEPVNDAVRRAMDTMNKHGCQVHFGRWLIEGSPYVVLFDIG
YSAWNLDKWKGDLWEACSVGIPYHDQEANDMLIFGSLTAWFLKEVTDHADGRHVIVQFHE
WQAGIGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHR
YCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYK
ARIQEFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSXXXXXAEGKNALEH
KRMHKSDVTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGE
IPDMNNILDRDDMTIMKRAIFSTQLILHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYE
PWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVADPTAYGIYIVDRRFCSPDDSCNQLTQF
LYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYQHARHLTLSRAFPEKFHMEPTSPPT
TEGFKYPRPPSVPPSPSGSQASSPQSSDAEGDDEDERYDEEEEAERDRLNIKSPFSLSHV
PRGKKKQHGEYKN
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggtcgatcgctatctgtgacatccctaggtgggctgcctcggtgggaagcc
ggacttcctgtggagaatttactgctctttgaagtctcttgggaagtgaccaataaagtc
ggtggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatggggagac
aactattttctgattggtccatattttgagcataatatgaagactcaggtggaacagtgt
gaacctgtgaatgatgctgttagaagagccatggacacgatgaacaaacacggctgccag
gtgcactttggaagatggctgatagaagggagtccttatgtggttctctttgacattggc
tattcagcttggaacctggacaagtggaaaggagacctctgggaagcatgcagcgttggc
attccttatcacgaccaggaagccaatgatatgctgatctttgggtcattaactgcctgg
ttcttgaaagaggtgacggaccatgctgatgggagacatgtcattgtccagttccatgaa
tggcaagctgggattggactgatcctttctcgagctcggaaactgcccattgctacagtc
tttaccacccacgccacactgcttgggcggtatctctgtgcagctaacatcgatttctac
aaccaccttgataagtttaacatagacaaagaggctggggaaaggcagatttatcaccgg
tattgcatggagcgcgcttccgtccattgtgctcatgttttcaccacagtttctgaaatt
accgcaatagaggcagaacacatgctgaagagaaaacctgatgtagttactccaaatggc
ttgaacgttaagaaattttcagctgtacatgagtttcaaaatctccatgctatgtacaag
gccaggatccaagagtttgttcgaggtcatttctatggtcatctggactttgatcttgaa
aaaacgttattcctcttcattgctgggaggtatgagttttcaaacaaaggagctgacatc
ttcttagaatccttatcnnnnnnnnnnnnnnnngctgagggtaagaatgctctagaacac
aagaggatgcataaaagtgacgtcaccgtggtggtgtttttcattatgcctgccaagaca
aacaatttcaatgtggaaaccctgaaaggccaggcagtgcgcaaacagctatgggacact
gcacattctgtgaaggaaaagtttggaaagaaactgtatgatgcattattaagaggagaa
attcctgacatgaacaatattttggaccgagatgatatgacaattatgaaaagagctatc
ttttcaactcagttgattttgcacccagagttcctgtcctccaccagccccttgctaccc
atggattatgaagagtttgtccgaggttgtcatcttggagtatttccatcttactatgaa
ccctggggttatactccagctgaatgcactgtgatgggcatccccagtgtgaccaccaat
ctctctggctttggctgtttcatgcaggagcatgtggctgaccccactgcatacggaatt
tacatcgttgacaggcggttctgctcacctgatgattcttgcaatcagctgactcagttt
ctctatggattttgcaaacagtcacgccgccagaggattattcaaaggaatcgaaccgag
aggctctcagatcttctggactggagatacttaggcagatattaccagcatgccaggcac
ctgacattaagcagagcctttccagaaaaattccacatggaacccacatcaccaccaacg
acagaaggatttaagtatcccaggccgccctcggtaccaccttctccgtcgggatctcag
gcctccagtcctcagagcagcgatgcggagggtgacgatgaggatgagagatacgacgag
gaggaagaggccgaaagggatcggttaaatatcaagtctccgttttctctgagtcacgtt
cctcgaggcaagaagaagcagcacggagaatacaagaattga

DBGET integrated database retrieval system