KEGG   Bos mutus (wild yak): 102273022Help
Entry
102273022         CDS       T02919                                 

Gene name
ST6GAL1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
bom  Bos mutus (wild yak)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102273022 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    102273022 (ST6GAL1)
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     102273022 (ST6GAL1)
Glycosyltransferases [BR:bom01003]
 Terminal extension
  Sialyltransferase
   102273022 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 420 aa AA seqDB search
MTRTSLKKKVFSCCVLIFLLFAIICVWKEKKKGNYYEFLKLQNKEYQVLQGLEKLAVSSS
SQPVSSSSTHNPQRNIQALGGPKAKLKATFQVWDKDSSSKNLAPRLQTIRKNYLNMNKYK
VTYKGPGPGVKFSAEALLCHLRDHVNISMIEATDFPFNTSDWEGYLPQEDIRTKAGPWGR
CAVGSFSGALQNCLSEELIEDKVVFVNEVSRLLGYDHDAVLRFNGAPTVKFQQDVGTKTT
IRLVNSQLVTTEAGFLKDSLYNEGILIVWDPSVYHSDIPKWYRNPDYSFFNNFKSYRKLH
PDQPFYILKPQMPWELWDSKWIFTRELIQPNPPSSGMLGIAIMMSLCDQVDIYEFLPSKR
KTDVCYYYQRYFDSACTMGAYHPLLFEKNMVKYLNLGTDEDIYLLGKATLPGFRTIRCGA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcaccagcttgaagaaaaaagtcttcagctgctgtgtgctcatctttctcctg
tttgccatcatctgtgtgtggaaagaaaagaagaaagggaattactatgagttccttaaa
ctgcaaaacaaggaataccaggtgttgcagggcctggagaaactggccgtgagctctagt
tcccaacctgtgtcctccagcagcacccacaacccccagaggaacatccaggcactcggt
ggtcccaaggccaagttgaaggctaccttccaggtgtgggacaaggacagctcctccaaa
aaccttgcccccaggctgcaaactatccggaagaattatctgaacatgaacaagtacaaa
gtgacgtacaaggggccagggcccggggtcaagttcagcgcagaggccctgctttgccac
ctccgggaccatgtcaacatttcaatgatagaggccacagattttcccttcaacacctct
gactgggagggctacctgcctcaggaggacattaggaccaaggctgggccgtggggcagg
tgtgctgtgggctctttttctggggcattacaaaactgtttatcagaggaactgattgag
gataaggttgtttttgtgaatgaggtatctagattgctggggtatgatcacgatgcagtc
ctgaggtttaatggggcacccacagtcaaattccaacaagacgtgggcacgaaaaccacc
attcgtctggtaaactctcagttggtcaccacagaagcaggcttcctcaaagacagtttg
tacaatgaaggaatcctaattgtgtgggacccatctgtttaccattcagatatcccaaag
tggtacaggaatcccgactacagtttcttcaataacttcaagagttatcgtaagctgcat
cctgatcagcccttttacatcctcaagccccagatgccttgggagctgtgggactcaaag
tggatatttacgagggagctgatccagccaaaccccccatcctctgggatgcttggcatt
gccattatgatgtcactgtgtgaccaggtggatatttacgagttcctcccatccaagcgc
aagactgacgtgtgctactactatcagaggtatttcgacagtgcctgcacaatgggcgcc
taccacccactcctctttgagaagaacatggtgaagtacctcaacctcggcacggacgag
gacatctacctgcttggaaaagccacgctgcctggcttccggacaattcgctgcggagca
taa

DBGET integrated database retrieval system