KEGG   Bos mutus (wild yak): 102273174Help
Entry
102273174         CDS       T02919                                 

Gene name
CKMT2
Definition
creatine kinase, mitochondrial 2 (sarcomeric)
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
bom  Bos mutus (wild yak)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102273174 (CKMT2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102273174 (CKMT2)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102273174 (CKMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 419 aa AA seqDB search
MASTFSKLLTGRNASLLFATLGTGALTTGYLLNKQNVCAAAREQHKLFPPSADYPDLRKH
NNCMAECLTPAIYAKLRNKVTPSGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
DLFDPVIKLRHNGYDPRVMKHPTDLDASKITQGQFDERYVLSSRVRTGRSIRGLSLPPAC
SRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG
MARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE
RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD
TAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccagtaccttctcaaagttgctgactggccgcaatgcctctctgttatttgctacc
ttgggcaccggtgccctgaccacggggtacctgctgaataagcagaacgtgtgtgctgcg
gctcgggagcaacacaagctattcccaccaagtgcagactaccctgacctgcgcaaacac
aacaactgcatggccgagtgcctcacgccggccatctacgccaagctccgcaacaaggtg
acgcccagcggctataccctggaccagtgcatccagaccggagtggacaaccctggccac
cccttcataaagaccgtgggcatggtggctggcgacgaggagtcctatgaggtgtttgcc
gacctttttgaccctgtcatcaagctgaggcacaatggctatgaccccagggtgatgaag
caccccacggatttggatgcatccaagatcactcaggggcagttcgacgagcgctacgtg
ctgtcgtctcgggtgcgcacagggcgcagcatccgcgggctgagcctgccgcccgcctgc
agccgggccgagcggagggaggtggagaacgtggccatcacggcactggagggcctcaag
ggggacctggccgggcgctactacaagctgtccgagatgacggagcaggaccagcagcgg
ctcatcgatgaccactttctatttgataagccagtatcccctttactaacttgtgctggg
atggcccgtgactggccagatgcccggggaatctggcataattatgacaagacatttctc
atctggattaatgaggaagaccacaccagagtaatctctatggagaaaggaggcaatatg
aaaagagtatttgagcgattctgtcgtggacttaaagaggtggaacgcttaatccaagag
cgaggctgggagttcatgtggaatgagcgcctggggtacattctgacctgcccttcgaac
ctcggcacgggattgcgagctggtgtccatgtcaggatcccaaagctcagcaaggatcca
cggttttctaagatcctggagaacctgagactgcagaagcggggcacaggcggtgtggac
actgcagcggtagcagacgtgtacgacatttccaacatagatcgaattggccgatcggag
gtcgagcttgttcagatagtcattgatggagtcaattacctggtggattgtgagaagaag
ctggagagaggccaggatattaaggtgccacctcctctacctcagtttggcaagaagtga

DBGET integrated database retrieval system