KEGG   Bos mutus (wild yak): 102273269Help
Entry
102273269         CDS       T02919                                 

Gene name
KAT2B
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
bom  Bos mutus (wild yak)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102273269 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102273269 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102273269 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    102273269 (KAT2B)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102273269 (KAT2B)
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102273269 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 757 aa AA seqDB search
MPRGEWGEPAREWEEPARGLGGASEGAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTES
CRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHREEDADTKQVYFYLFKLLR
KSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPPKERQTIVELAKMFLNRI
NYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETAQVFGRTLLRSV
FTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSR
TSQLGIQTVISPPPVAGTVSYNSSSASLEQQNGGSASPSCRGASGLEANPGEKRKMNESH
VLEETKKPRVMGDIPLELIHEVMSTITDPTAMLGPETNFLSAHSARDEAARLEERRGVIE
FHVVGNSLSQKPNKKVLMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVI
GGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIG
YFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIE
RKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGRERSKEARDPDQLYSTLRSI
LQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRV
FTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLIDK
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggggggaatggggggagccggcgagggagtgggaggagcccgcgcggggactg
ggaggagccagcgagggagcagaggaatcttgtaaatgcaatggctggaaaaaccccaat
ccttcgcccacgccccccagagccgacctgcagcagatcatcgtcagcctgacggagtcc
tgccggagctgcagccatgccctcgctgctcacgtgtcgcatctggagaacgtgtcggag
gaggagatgaacagactgctgggcatcgtgctggatgtggagtatctctttacctgcgtc
cacagggaagaagatgccgacaccaagcaggtttatttctacctgttcaagctcttgagg
aagtctattttacaaagaggaaaacctgtggttgaaggttctttggagaagaagccccct
tttgaaaaacctagtattgaacagggtgtgaataactttgtacagtacaaattcagtcac
ctgccacccaaagaaaggcaaacgatcgttgagctggcaaaaatgttcctgaaccgtatc
aactattggcatctggaggcaccatctcagcgaagactgcgctctcccaacgatgacatc
tctgggtacaaggagaactacaccaggtggctgtgttactgcaacgttccccagttctgc
gacagcctgccgcggtacgagacggcccaggtgttcgggaggacgctgctgcgctccgtc
ttcactgtgatgcggcggcagctgctggagcaggcgaggcaggagaaggacaaactgccg
ctggagaagcggactctgatcctcacacacttcccgaagtttctgtccatgttagaagaa
gaagtttatagtcaaaactctcctatctgggatcaggattttctctcagcttcttccaga
accagccagcttggaatccaaacagttatcagtccacctcccgtggccgggacagtttcc
tacaattcaagctccgcttcccttgaacagcagaacggagggagcgccagtccgtcctgt
cgaggcgcatccgggcttgaggcaaacccaggagaaaagaggaaaatgaacgagtctcat
gttttggaggagaccaagaagccccgggtgatgggcgatatcccactggagttaatccac
gaggtcatgtccaccatcacagaccccaccgcgatgcttgggccagagaccaactttctg
tcggcgcactcggccagggacgaggcggccaggcttgaggagcggaggggtgtaatcgag
ttccacgtggtgggcaactccctgagccagaagcccaacaagaaggtgctcatgtggctg
gtagggctgcagaacgtgttctcgcaccagctgccgcgtatgcccaaggagtacatcacc
cggctcgtcttcgacccgaaacacaaaacccttgctttaatcaaagatggccgtgtcatt
ggcggtatctgcttccggatgttcccgtcccagggcttcacagagattgttttctgcgct
gtaacctctaacgaacaagtcaagggctatggaacacacctgatgaaccacttgaaggaa
taccacataaaacacgacatcctgaacttcctcacctacgcagatgaatacgcaattgga
tatttcaagaagcagggtttctccaaagaaattaaaatccctaaaaccaaatatgttggc
tacatcaaggattatgaaggcgccactttaatgggatgtgagctaaatccacggatcccg
tacacggagttctctgtcatcattaagaagcagaaggagatcattaaaaagctgatagaa
agaaaacaagcccagattcggaaagtctacccgggactttcctgttttaaagatggagtt
cggcagatcccgatagaaagcattcctggaattcgagagacaggctggaagccgagtgga
agagagagaagtaaagaggccagagaccccgaccagctgtacagcacgctcaggagcatc
ctgcagcaggtgaagagccatcaaagcgcttggcccttcatggaacccgtgaagagaaca
gaagctccgggatattatgaagttataaggttccccatggatctgaaaaccatgagtgaa
cgcctcaagaataggtactacgtgtctaagaaactgttcatggcagatttgcagcgagtc
tttaccaattgcaaagagtacaacccccctgagagtgaatactacaaatgtgccagtatc
ctggagaaattcttcttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system