KEGG   Bos mutus (wild yak): 102273435Help
Entry
102273435         CDS       T02919                                 

Definition
lysozyme C-1-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
bom  Bos mutus (wild yak)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:bom00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    102273435
Enzymes [BR:bom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102273435
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102273435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 147 aa AA seqDB search
MKALIILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPSSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKQIVSE
QGITAWVAWKSHCRDHDVSSYVEGCTL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcattattctggggtttctcttcctttctgttgctgtccagggcaaggtc
tttgagagatgtgagcttgccagaactctgaagaaacttggattggatggctataaggga
gtcagtctggcaaactggctgtgtttgaccaaatgggaaagcagttataacacaaaagct
acaaactacaatcctagcagtgaaagcactgattatgggatatttcagatcaacagcaaa
tggtggtgtaatgatggcaaaacccctaacgcagttgacggctgtcatgtatcctgcagc
gaattaatggaaaatgacatcgcgaaagctgtagcgtgtgccaagcagattgtcagtgag
caaggcattacagcatgggtggcatggaaaagtcactgtcgagaccatgacgtcagcagt
tatgttgagggttgcacgctgtaa

DBGET integrated database retrieval system