KEGG   Bos mutus (wild yak): 102273748Help
Entry
102273748         CDS       T02919                                 

Definition
ecto-ADP-ribosyltransferase 5-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102273748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 340 aa AA seqDB search
MLHCDDIKFHVWCGDQSVGKGLEGQEVEALATPFPLPDATLLSFLSSCSGHFSCRFPLIQ
ACDEHSDITSKDLDLAPDTFDDSYVGCLEEMEEVAVHLLQREMVHHTWLWDAWETARKYW
EQKSPGLSLPTGFKTEHGIAIVLYTNSSNTLYRELNQAVRTGGGSWESYMKHFPFKALHF
YLTRALQLLRGGGGCSREPRQEVFRGSIRLGQFASSSLDEAVARGFGSATFFSLRTCSGA
PIQALSVFPEEREVLIPPYEVFVVSNFSKDGNKSLMTLSSSDQMCSHFNCAYLGEKKRLS
CESVPIGGQADSLSKGAFSLLSWKTLLLASWGFQLLGAGL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgctgcactgtgatgacatcaaatttcatgtttggtgtggggatcagagtgttgggaag
ggcctggaaggccaggaagtggaggcactggcaaccccttttcctctcccagatgctacc
cttctgtcgttcctgtcatcctgctcagggcacttctcttgtcggtttcccctcatccag
gcctgtgatgaacattccgatattacctccaaggacctggatctggctccagacaccttt
gatgattcctatgtgggctgcttggaagagatggaggaggtggcagtccatctgctacag
agggagatggtccaccatacctggctgtgggatgcctgggagacagctaggaagtactgg
gagcaaaaaagtccagggctcagcctgcctacgggcttcaaaaccgagcatggaatcgcc
attgtgctctacaccaactcatccaacactttgtaccgggagctaaaccaggctgtgcgg
actggcggaggctcctgggagtcctacatgaagcacttccctttcaaggccctgcatttc
tacctgacccgggccctgcagctgcttcggggtggtgggggctgcagcagggaacccagg
caagaggtgttccgtggctctatccgcttgggccagtttgcctccagctcgctggatgag
gcagtggcccgtggatttggtagtgccaccttcttctctctaaggacttgctctggagcc
cccatccaggccctgtctgtctttcctgaggagcgtgaggtgctgatccccccatatgaa
gtcttcgtggtgagcaacttctccaaggatggaaacaaaagcctgatgactctctcgagc
agtgatcagatgtgcagccactttaactgcgcctatctgggtgagaagaagaggctgagc
tgtgagtctgtgccaataggagggcaggcagactcactctccaagggggccttctctctg
ctgtcctggaagaccctgctcttggcctcttgggggttccagctcttaggagctgggctc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system