KEGG   Bos mutus (wild yak): 102274324Help
Entry
102274324         CDS       T02919                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102274324 (ART1)
Cellular antigens [BR:bom04090]
 Proteins
  102274324 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 254 aa AA seqDB search
MQSPAVMSLLLVSMGLMEALQAQSHPVIRRDLLSREMPLDMALTSFDDQYAGCATAMAAA
LPELNRTEFQANKVYADGWVQASRLTXALQLLSSGQRPPQCHQVFRGVQGLRFRPAGPGA
TVRLGGFASASLQDAAAQHFGEDTFFGIWTCLGAPIKGYSFFPGEEEVLIPPFETFQVIN
ASRPAQGPSRIYLRAVGKRSTYNCEYIKDKQCKSERCRLGNSAVGQSPLSAVWSLLLLLW
FLVGEVFPESPGFL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccctgccgtgatgtctctgttgcttgtgtccatgggcctcatggaagcactt
caggcccagagccaccccgtcatacgacgagacctcctctctcgagaaatgcccctagac
atggccctgacctcctttgatgaccagtatgctggctgtgccacagccatggcagcggct
ctcccggaactcaaccgcacagagttccaggccaacaaagtgtacgctgatggctgggtg
caggcaagcaggctgacctaggccctgcagctgctgagcagcggccagcgtccaccccag
tgccaccaggtgttccgaggggtgcagggcctgcgcttccggccggccgggcctggggcc
actgtcaggctggggggctttgcctccgcgtccctgcaggatgctgcggcccagcacttt
ggggaagacaccttctttggcatctggacttgccttggggccccaatcaagggctactcc
ttcttccctggggaggaggaagtgctgatccctccctttgagaccttccaggtgatcaac
gccagcaggccagcccagggcccctcccgcatctacctccgggccgtgggcaagcgcagc
acatacaactgcgagtacatcaaagacaagcaatgcaagtctgagcgctgccgtctgggt
aactcagccgtgggtcagagccccctttctgcagtctggtcccttctactgctgctctgg
ttccttgttggcgaagtctttccagagagtccaggcttcctctaa

DBGET integrated database retrieval system