KEGG   Bos mutus (wild yak): 102274413Help
Entry
102274413         CDS       T02919                                 

Gene name
ENTPD2
Definition
ectonucleoside triphosphate diphosphohydrolase 2
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
bom  Bos mutus (wild yak)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    102274413 (ENTPD2)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     102274413 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 443 aa AA seqDB search
MFIYKWPADKENDTGIVGQHSSCDAQGAGISSYADNPSGAGQSLVECLNQALRDVPKERH
AGTPLYLGATAGMRLLNLTSPEASANVLAAVTQTLTQYPFDFRGARILSGQDEGVFGWVT
ANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPTEDPANEVQLRLYGQR
YRVYTHSFLCYGRDQVLWRLLARVLQTHGSHPCWPRGYSTHVMLWDVYESPCTAAQRPQA
FNRSARVSLAGSSDPALCRSLVSQLFNSSSCHFSRCSFNGVFQPPVAGKFIAFSAFFYTM
DFLRTVMGLPVATLQQLEGAVVTLCNQTWSELQARAPDDRARLPDYCAGAMFVQQLLSRG
YGFDERSFGGVTFQKKAGDTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFA
AMLLAAFALLLHQARSTKSASTI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttcatctacaagtggccggcggacaaagagaatgacacaggcatcgtgggccagcac
agctcctgtgacgcgcaaggtgcaggcatctctagctatgctgacaacccttctggagcc
gggcagagccttgtggaatgcctgaaccaggcgcttcgggacgtgcccaaggagagacac
gcgggcacgccactctacctgggagccacggcgggcatgcgcctgctcaacctgaccagt
ccagaggcttcagccaatgtgctagctgccgtgacgcagacgctgacccagtaccccttt
gacttccgcggtgcccgcatcctctcaggccaggatgagggcgtgtttggctgggtgacc
gccaactacttgctggaaaacttcatcaagtatggctgggtaggccggtggttccggcca
aggaaggggacgctgggggccatggacctggggggagcctccacacagatcaccttcgag
acgaccagccccacggaggatccggccaacgaggttcagctccggctctacggccagcgc
taccgagtgtatactcacagcttcctctgctacggccgtgaccaggttctgtggaggctg
ctagcccgtgtgctccagacccacgggtcccacccctgctggccacggggctattccact
cacgtgatgctctgggatgtctacgagtcgccctgtactgctgcccagcggccccaggcc
ttcaacaggagcgccagggtcagcctggcgggcagcagtgaccctgccctatgccgcagc
cttgtctcccagctctttaactcctcctcctgccacttctccagatgctccttcaacggc
gtcttccagccccctgtggctgggaagtttatcgccttctctgctttcttctacacgatg
gacttcctgagaacggtgatggggctgcccgtggcaactctgcagcaactagagggggct
gtagtcaccctctgcaaccagacatggagtgagctgcaggctcgggcgccggacgaccga
gcccgcctgcccgactactgtgccggggcgatgttcgtgcagcagctgctgagccgcgga
tacggcttcgacgagcgctccttcggaggcgtgaccttccagaagaaggccggggacact
gcggtcggctgggcgcttggctacatgctgaacctgaccaacctgatccccgctgacccg
cctgggctgcgcaaaggcacagacttcagctcctgggtcgtcctcctcctgctcttcgcc
gccatgctcctggccgcgtttgccctcctgctgcaccaggcacgctccaccaagtcggcg
agcaccatctag

DBGET integrated database retrieval system