KEGG   Bos mutus (wild yak): 102274475Help
Entry
102274475         CDS       T02919                                 

Gene name
CES3
Definition
carboxylesterase 3
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102274475 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 570 aa AA seqDB search
MGTVVRTGSRALVGVACLLLAFSATDTGPGVTQPEADTPLGRVRGRQVGVKGTDRLVNVF
LGIPFAQPPLGPHRFSAPRPAESWEGVRDASRAHAVCPQDLERMNNSRFMLDGKHQTFPI
SEDCLILNIYSPAEAPSGAGRPVMVWFHGGSLVTGTATSHDGSALAAYGDVVVVTVQYRL
GFLGFFSTGDKHAPGNWGFLDVVAALRWVQGNITPFGGDFNSVTIFGESSGASVVSALVL
SPLAAGLFHRAIAQSGIITIPGLLDPNPWLLAQTLAESLACNSDSSAEMVQCLRQKTIKE
MILAYKSKKIASYNIDGTFFPKSAEELLRERQFPSVPFLFGFNNHEFGWLIPRGWGFLDK
MDQLSLEDMLAILRPSLTNMDVPTEVMPTIIKEYLGSSSDGQAKREAFQKLISDIIITLP
MLQFARDLQDSGVSIFFYEFQHRPSSFAKIKPAWVQADHGAELTFMFGGPFLTDESSMLA
FPEATEEEKQLSLTMMAQWTNFAWTGDPNGKGLPLWPPFNHAEEYLEISLVPRVNQKPRE
ARMQLWEEILPTKFGQWQQKQKGKKVQEEL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggcacagtggtaagaaccgggtccagggccctggtcggggtggcctgtctgctcctg
gcattctctgctacagacactgggccgggggtcactcagcctgaagcggacacacccctg
ggccgtgtgcgaggccggcaggtgggcgtgaagggcacagaccgtcttgtgaatgtcttc
ttgggcatcccattcgcccagccacccctggggccccaccggttctcggccccgcgccca
gcggagtcttgggagggcgtgcgagatgccagtagggcccacgccgtgtgcccacaggat
ctggagagaatgaacaacagcagatttatgctggatggaaagcaccagaccttccccatt
tcggaggactgcctgatcctcaacatatacagcccggctgaggccccctcgggggcagga
aggccagtcatggtgtggttccacgggggctctctcgtgactggcaccgccacctcccac
gatgggtctgccctggccgcctatggggacgtggttgtggtcacagtccagtaccgcctg
ggcttccttggctttttcagcactggagacaagcacgctcctggcaactggggcttcctc
gacgtcgtggctgctctgcgctgggtgcaggggaacatcaccccctttgggggtgacttc
aactctgtcaccatctttggtgaatctagcggggcctctgtcgtctctgccctggtcctg
tccccgctggctgcagggctgttccacagagctatagcacagagtggaatcatcaccata
ccggggttactggatcctaacccctggctcctggctcagaccctcgcagaatccttggcc
tgcaactctgactcctcggctgagatggtgcagtgccttcggcagaagacgatcaaggag
atgatcctcgcctacaagtcgaaaaaaatagcttcgtacaacatcgacggcaccttcttt
cccaagagcgctgaggagctcctgagggagaggcagttcccctctgtgcccttcctcttc
ggtttcaacaaccatgagtttggctggctcatccccaggggctggggtttcctggataag
atggatcaactgagcctggaggacatgctggccatcctgaggccctccttgaccaatatg
gatgtgcccactgaggtgatgcccaccatcataaaggaatacctaggcagcagctcagat
ggacaagccaagcgagaggccttccagaaattgataagtgacattatcataaccttaccc
atgttgcaatttgcgagagacctccaagactctggggtctccatctttttctatgagttc
cagcatcgacccagttcttttgcgaagatcaagccagcctgggtgcaggctgatcatggg
gctgagttgaccttcatgttcggcggtcctttcctcacggatgagagctccatgttggcc
tttccagaagccacagaagaggagaagcaactgagcctcaccatgatggcccagtggacc
aactttgcctggacaggggaccccaatggcaaggggctgcctctttggccaccattcaac
catgcggaggaatacctggaaatcagcctggtgccacgggtcaaccagaagccaagggag
gccagaatgcagctctgggaagagatacttcccaccaagttcgggcagtggcagcagaag
cagaagggcaagaaggtccaggaggaactctga

DBGET integrated database retrieval system