KEGG   Bos mutus (wild yak): 102274697Help
Entry
102274697         CDS       T02919                                 

Gene name
PADI1
Definition
peptidyl arginine deiminase, type I
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
bom  Bos mutus (wild yak)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 663 aa AA seqDB search
MAQRSAVRLSPKKPSYAVCAVGVETHLDVHSDVPEGAENFGVSGSSGVKIFMVYDPARVT
EPTGRAYWPLDASVEVVISVDAASKALNDLKVKISYFGQPARGALGHSVLYLTGADISLD
ADTGRTGNVKRSQADKERWRWGPEGYGAVLLVNCDRDSLRSVGTDLTDTQLASRDDLQDM
SPVVLTCDAPDALFESYKLVLNVPPSDSKRMRVFCARGGNSLLDYEQVLGPQHLSYAVAR
QPGERKIGLYVEGLSFPDANFLGLVSLSVSLVDTKTLPEVPLFTDTVAFRVAPWIMTPNT
QPPLELYVCSVLDSHGPNAQFLSDMSDLALKASCKLMICPRVENRNDRWIQDEMEFGYTE
APHKAFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIQSTGVSGLDSFGNLDVSPPVVV
EGKEYPLGRILIGSCLPRSGGRRMAKVVRDFLGAQRVQAPLEVYSDWLSVGHVDEFLTFV
PTSDQKGFRLLLASPSACLKLFQKKKEEGYGEAAQFDGLEHQVKRSINEMLADRRLRNDN
LYAQRCIDWNREVLKRELGLTEHDIVDIPQLFSLKDAYAEAFFPDMVNMVVLGRHLGIPK
PFGPLINGRCCLEEEVRSLLEPLGLHCTFIDDYLAYHKLLGEIHCGSNVRRKPFPFKWWH
VVP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcgcagtgctgtgcggctgtccccgaagaagcccagctacgccgtgtgtgct
gtgggggttgagacacacctggacgttcacagtgatgtgcctgagggtgctgagaacttt
ggagtttctgggagctccggggtgaagatcttcatggtctatgacccagcgcgggtgaca
gagcccacgggcagggcctactggcccctggatgccagcgtggaagtggtcatatcggtg
gacgcagccagtaaggctttaaatgacctcaaggtgaagatctcctacttcgggcagccg
gcgcgcggggccctgggccacagcgtgctctacctcacaggcgccgacatctccctcgac
gctgacactggccgcacgggcaatgtgaaaaggagccaagccgacaaggaacgctggcgc
tggggccctgagggctatggggctgtcctgctggtgaactgcgaccgggacagcctcagg
tccgtagggacggacctcaccgacacccagctggcctcgcgggatgaccttcaggacatg
tccccagtggtgctgacctgcgatgcccctgatgcactctttgagagctacaagctggtc
ttgaacgtgccaccttctgattccaaaagaatgcgggtcttctgcgcccggggtgggaat
tccctcctggactatgagcaggtgctggggccccagcacctgtcctacgcagtggcccgt
cagcccggggagcggaagatcggcctctatgtggaggggctcagctttcccgacgctaat
ttcttggggctggtctccctcagcgtcagcctggtagacaccaagaccctgcctgaggtg
cccctcttcacagacaccgtggccttccgcgtggccccctggatcatgacccccaacacc
cagccccccctggagctgtatgtgtgcagtgtcctagactctcatggcccgaatgcgcag
tttctgagtgacatgtctgatctggcgctgaaagccagctgcaagctgatgatctgccct
cgggttgagaaccgaaatgaccgctggatccaggatgagatggagtttggctacactgag
gccccgcacaaagccttccccgtggtcttcgactccccccgaaacagaggcctgaaggat
ttcccttataagaggatactgggtcctgactttggatatgtaacccgggaaatccagtct
accggtgtctctggccttgactcctttggcaacctggacgtcagcccgccagtcgtggtg
gagggcaaggagtatcccctgggccggatcctcatcggcagctgcctccccaggtctggc
gggcggcgcatggccaaggtggtgcgcgacttcctgggtgcccagcgggtgcaggcgccc
ctggaggtctactccgactggctctccgtgggccacgtggacgagttcctcaccttcgtg
cccacctccgaccaaaagggtttccggcttctcctggccagccccagcgcgtgcctcaaa
ctgttccaaaagaagaaagaggagggctatggggaagcagcccagtttgacggcttagag
caccaggtgaagagaagcattaacgagatgctggccgacaggcgtctcaggaacgacaac
ctctatgcacagaggtgcatcgactggaaccgggaggtgctgaagcgggagctgggcctc
accgagcatgacatcgtggacatcccgcagctgttctccctgaaggacgcctatgcagaa
gccttcttccccgacatggtgaacatggtggtcttaggccggcacctgggcatccccaag
cccttcgggcccctcatcaacggccgctgctgcctggaggaggaggtgcggtccctgctg
gagccgctgggcctccactgcaccttcatcgacgactacttagcctaccacaagctgctc
ggggagatccactgtggcagcaacgtgcgccggaagcccttccccttcaagtggtggcac
gtggtgccctga

DBGET integrated database retrieval system