KEGG   Bos mutus (wild yak): 102275039Help
Entry
102275039         CDS       T02919                                 

Gene name
CES2
Definition
carboxylesterase 2
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
bom  Bos mutus (wild yak)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102275039 (CES2)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102275039 (CES2)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     102275039 (CES2)
    3.1.1.84  cocaine esterase
     102275039 (CES2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 553 aa AA seqDB search
MKPDGPRLRLRAVAFGFLLLLVPGQGQDSTRPVRTTHTGKVQGSLVYVNNADVGVHTFLG
IPFAKPPVGPLRFAPPEPPESWSGVKDGTSQPAKCPQDADGMKSMELWNVTLPSTSMSED
CLYLNIHTPAYSHEGSNLPVMVWIHGGGLVLGMASMYDGSALAAFGDVVVVVIQYRLGLL
GFFSTGDKHATGNWGYLDQVAALRWVQQNIAYFGGDPGRVTIFGESAGGISVSLHVISPM
SQGLFHGAIMESGVALLPGLTINSSDKVAKVVANLSACGQVDSEALVDCLRHKNEEEVLA
INKLVKIIPGVVDGIFLPKHPLELLASDDFQPVPSIIGVNNDEYGWIIPLSVNNSDTRRE
ISRESVRNALQELSTMTTMPPEFGELLMEEYIEDSEDHQTLQNQLHEIMGDYLFVIPALQ
VAMFHRSHAPVYFYEFQHQSSFFKDVRPSSVRADHGDEVLFLFRNEQIQFTEEEELLSRK
MIKYWANFARNQNPNGEGLPHWPMFDQEDQYMQLNTQPAVGRALKAHRLQFWMNTLPQKT
QELMETKEKHTEL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggacgggcctcgcttgcgtctgagggccgtggccttcgggttcttgcttctc
ctcgtcccgggccagggccaggactcaacccgccctgtccgaaccacacacacagggaag
gtacaggggagccttgtctacgtgaataatgctgatgtgggggtccacaccttcttggga
attccctttgccaagccacctgtagggccgctgcgatttgcacccccggagcccccagaa
tcttggagtggtgtaaaggatgggacttcccagccagccaagtgtccgcaggacgccgac
ggcatgaaaagcatggaactatggaatgtgaccctgccttctacctccatgtctgaagat
tgtctgtacctcaacatccacacacctgcctattcccatgagggctccaatctgcctgtg
atggtgtggatccatggtggcgggcttgtcctgggcatggcatccatgtatgacggctct
gcactggcagcctttggagacgtggtggtggtcgttatccagtaccgcctgggtttgctg
ggcttcttcagcactggagacaagcacgcaactggcaactggggctacctggatcaagtg
gccgcactgcgctgggtccagcagaatatcgcctactttggaggcgaccctggccgtgtc
acaatttttggcgagtctgcgggtggcataagcgtgtctttgcatgtcatatcccccatg
tcccaaggactcttccatggcgccatcatggagagtggcgtggccctgctgcctggcctc
accatcaactcatctgacaaggtcgccaaagtggtagccaacctgtctgcctgtggccag
gttgactcagaggccctggtggactgcctgcggcacaagaatgaagaggaggttctggcc
atcaacaagctcgtcaagatcatccccggcgtggtggatgggatcttcctgcccaagcac
cccctggagctgctggcctctgacgactttcaacctgtccccagcatcattggtgtcaac
aatgatgagtatggttggatcatccccttgagcgtgaacaattctgacactaggagggaa
ataagcagagagtccgtgaggaatgccttgcaggaattgtcaacaatgacgactatgcct
cctgagtttggtgagctgttgatggaggagtacatagaggacagtgaagaccaccagacc
ctccaaaaccagctccatgagattatgggggactacctttttgtgatccctgcactccaa
gtagcaatgtttcatcgttcccacgcccccgtctacttctacgagttccaacatcagtcc
agcttcttcaaggatgtcaggccgagctctgtgagggcggaccatggagatgaggttctc
ttcctcttcaggaatgagcaaatccaattcacggaggaggaggagctgctgagcaggaag
atgatcaagtattgggccaactttgctcgaaatcagaaccccaatggtgagggtctgccc
cactggccgatgttcgaccaggaggaccaatacatgcagctgaacacgcagcctgcagtg
ggccgggccctgaaggcccacaggctccagttctggatgaataccctaccccagaagaca
caggagctaatggagaccaaggagaagcacacagaactatag

DBGET integrated database retrieval system