KEGG   Bos mutus (wild yak): 102277419Help
Entry
102277419         CDS       T02919                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
bom  Bos mutus (wild yak)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102277419 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102277419 (PIK3CG)
   04072 Phospholipase D signaling pathway
    102277419 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    102277419 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    102277419 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102277419 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    102277419 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102277419 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    102277419 (PIK3CG)
 Human Diseases
  Infectious diseases
   05145 Toxoplasmosis
    102277419 (PIK3CG)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102277419 (PIK3CG)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102277419 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1104 aa AA seqDB search
MELENHEQPVVLREDNCRRRRRMKPRSTAASMSSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLRVLETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLHYWKVLHRSPGQIHLVQRHSPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIFIIIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASAETPSPESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQLSGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLRDFTQQVQVIDMLQKVTIDIKSLSAEKYDVSSQVIFQLKQKLEILQNLNLP
QSFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLSHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIXXXXXXXXXXXXXXQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDK
GWTVQFNWFLHLVLGIKQGEKHSA
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaaccatgaacagcctgtggtgctgagagaggacaactgccgcaggcgc
cggaggatgaagccacgcagcacggcggccagcatgtcctccatggagctcatccccatt
gagttcgtgctgcccaccagccaacgcaacaccaagacccccgaaacggcgctgctgcat
gtggccggccacggcaacgtggagcagatgaaggcccaagtgtggctgcgcgtgctggag
accagcgtggccgccgacttctaccacaggctgggcccggaccacttcctcctgctctac
cagaagaaggggcagtggtatgagatctatgacaagtaccaggtggtgcagaccctggac
tgcctgcactactggaaggtgctgcaccggagccccgggcagatccacctggtacagcgg
cactcgccctcagaggagacgctggccttccagcgccagctcactgccctcatcggctac
gatgtcacagatgtcagcaatgtgcacgacgacgagttggagttcacacgccgccgcctg
gtcaccccgcgtatggccgaggtggctggccgcgaccccaagctctatgccatgcacccc
tgggtgacgtctaagcccctccctgagtacctgctaaagaagatcaccaacaactgtatc
ttcatcattattcaccgcagcaccaccagccagaccatcaaggtctcagctgatgatacc
cctggcaccatcctccagagcttctttaccaaaatggccaagaagaagtccctgatggat
atccccgagagccagaacgaacaggactttgtgctgcgtgtctgtggccgcgatgagtac
ctggtgggcgagacgcccatcaaaaactttcagtgggtgcggcagtgccttaagaatggt
gaagagattcacctggtgcttgacactccgccggacccagccctggatgaggtgaggaag
gaagagtggccgctggtggatgactgcaccggagtcactggctaccatgagcagctaacc
atccatgggaaggaccatgagagcgtgttcactgtgtccctgtgggactgtgaccgcaag
ttcagagtcaagatcaggggcatcgatatccccgtcctgccccggaatgcagatctcacg
gtttttgtggaggcaaacatccagtatgggcagcaagtcctttgccaaagaagaaccagc
ccaaaacccttcacggaggaggtgctctggaatgtgtggcttgagttcagtatcaagatc
aaagacttacccaaaggggctctgctcaacctccagatctactgtggcaaagcaccagct
ctgtctggtaaggcctctgcagagactcccagtcccgagtccagaggcaaagctcagctt
ctctactacgtgaacttgctgctcattgaccaccgattcctcctgcgccacggcgagtac
gtgctccacatgtggcagttatctgggaagggggaagaccaagggagcttcaatgcagac
aagctcacatctgccaccaatcccgacaaggaaaactcaatgtccatctccattctcctg
gacaactactgtcaccccatagccttgcctaagcatcagcccacccctgacccggaaggg
gaccgcgtacgagcagaaatgcccaaccaacttcggaagcaactggaggcaatcatagct
actgatccacttaaccctcttactgcggaagacaaagaattgctttggcatttcagatat
gaaagccttaaggatcccaaagcataccctaagctctttagctcagtgaaatggggacag
caagaaattgtggccaaaacatatcaattgttagccagaagggaggtctgggatcaaagt
gctttggatgttggattaacaatgcaactcctagactgcaacttttcggatgaaaacgta
agagccattgcagttcagaaactggagagcttggaagacgatgacgttctgcattacctg
ctccaattggtccaggctgtgaaatttgaaccataccatgacagtgcccttgccagattt
ctgctgaagcgtggtttaagaaacaaaagaattggtcacttcttgttttggttcttgaga
agtgagattgcccagtcgagacactatcagcagaggtttgcagtgatcctggaggcctac
ctgaggggctgtggcacggccatgctacgggacttcactcaacaagtccaagtaatcgac
atgttacaaaaagtcaccattgatattaaatcactctctgccgaaaagtatgacgtcagc
tcccaagttattttccaactaaagcaaaagcttgaaatcctgcagaatttgaatctcccc
caaagctttagagttccatatgaccctggactgaaggcaggcacactggtgattgaaaaa
tgtaaagtgatggcctctaagaaaaaacctctgtggcttgagtttaaatgtgctgaccct
acagctctatcaaatgaaacaattggaattatctttaaacacggtgatgatctacgccaa
gacatgcttattctacagattctacgaatcatggagtccatttgggagactgaatctttg
gatctgtgcctcctgccatatggttgcatttcaactggtgacaaaataggaatgattgag
attgtaaaagatgccacaacgatcgccaaaattcagcaaagcacagtgggcaacacggga
gcctttaaagatgaagtgctgagtcactggctcaaagaaaaatgccctattgaagaaaag
tttcaggcagcggtggagagatttgtttattcctgtgctggctactgtgtggcaaccttt
gttcttgggataggcgacagacacaatgacaatattatgatctcagagacaggaaatcta
tttcatattgactttgggcacattcttgggaattataaaagtttcctgggcattaataaa
gagagagtgccattcgtgctaactccagacttcctgtttgtgatggggacttctggaaag
aagacaagtctacacttccagaaatttcaggatgtgtgcgtcaaggcttacctagccctt
cgtcatcacacaaacctactgatcatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnncccagttaaccagcaaagaagatattgaatacattcgggatgccctaacagtaggg
aagagcgaggaggatgctaaaaagtattttctggatcagattgaagtttgcagggacaaa
ggatggactgtgcagtttaactggttcctacatcttgttcttggcatcaaacaaggagag
aaacattcagcctaa

DBGET integrated database retrieval system