KEGG   Bos mutus (wild yak): 102277719Help
Entry
102277719         CDS       T02919                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
bom  Bos mutus (wild yak)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 628 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTETFEVYGTPGVDIYICPNVERDR
ERADARRWHFDMGSQIIVVMNSPSNELNDSHVQISYHSSRDSSPLAYALLYLTCVDITLD
CDLNCEGRQDRDFVDKRQWVWGPGGHGAILLVNCDRDSMSSDDQDNCDHHVRCLQDLEDM
SVMILRTQGPNALFDDHKLVLHTSSADAERARVFHACGPEDSCEAYRHVLGQNKVSYEVH
RFHGDEERFFVEGLSFPDAGFSGLVAFHVTLLDDSNEDFSESPIFTDTVVFRVAPWIMTP
STQPPLEVYVCRVKNNTCFVHAVAELARRAGCKLTVCPQAENRNDRWIQGPDFGYVTREP
QDNSVSGLDSFGNLEVSPPVVANGKEYPLGRILFGGNLPGSRGRRVTQVVRDFLHAQRVQ
PPVELFVDWLAVGHVDEFLSFVPVADGKGFRMLLASPSACLKLFQEKQKWGHGGALLFQG
VAGNQEVNTVSISQVLSNGNLISYNKFVQSCIDWNREVLKRELGLAERDIVDIPQLFKME
RRKAVAFFPDLVNMLVLGQHLGIPKPFGPVINGRCCLEEKVRSLLEPLGLHCTFIDDFTP
YHMLHWNVHCGTNVRRQPFSFKWWHMEP
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcagaggattgtgcgcgtgtccctggaacaccccaccagtgccgtgtgtgtg
gctggagtcgagaccctggtggacatttatgggtcagttcccgagggcacagagacgttc
gaggtctacggaacccccggcgtggacatctacatctgccccaacgtggagagggaccgg
gagcgtgcggatgcccggcggtggcactttgacatgggctcccagatcatcgtggtcatg
aactctcccagcaacgagctcaacgacagtcacgttcagatttcctaccattccagccga
gactcctcgcccctggcctacgcgctgctctacctcacctgtgtggatatcaccctggac
tgtgacctgaactgtgaaggcaggcaggacagggactttgtggacaagcggcagtgggtc
tggggacccggtgggcacggagccatcctgctggtgaactgcgacagagacagtatgagc
tctgacgaccaggacaactgtgaccaccacgtgcgctgcctgcaagacctagaagacatg
tctgtgatgattctgcggacacaaggccccaatgccctgtttgacgaccacaaactcgtc
ctccacacttccagcgctgacgccgagcgggcgcgggtgttccacgcctgcggccccgag
gactcctgcgaggcgtaccggcacgtgctcggccagaacaaggtgtcctacgaggtgcac
cgcttccacggcgacgaggagcgcttcttcgtggagggcctgtccttccccgacgccggc
ttctcggggctcgtcgccttccacgtcaccctgctggacgactccaacgaggatttctcc
gagtcccccatcttcaccgacaccgtggtgttccgagtggccccctggatcatgacaccc
agcacccagccgcccctggaggtgtacgtgtgccgcgtgaagaacaacacgtgcttcgtg
catgcggtggcggagctggccagaagggctggctgcaagctgactgtctgcccgcaggcc
gagaaccgcaatgaccgctggatccagggtccagatttcggctatgtgacccgggaacca
caagacaactctgtaagcggcctggactccttcgggaacctggaggtcagcccccctgtg
gtagccaacgggaaggagtaccccctggggcggatcctcttcggaggcaacttgcctggg
tcaaggggccgccgggtcactcaggtggtccgggacttcctgcatgcccagagggtgcag
ccgcccgtcgagctcttcgtggactggctggcagttggccatgtggatgagtttctgagc
ttcgtccctgtcgctgacgggaagggcttccggatgctcctggccagccccagcgcctgc
ctcaagctcttccaggaaaagcagaagtggggccacgggggcgccctcctgttccaaggg
gttgccggcaaccaggaggtcaacaccgtctccatcagccaggtcctctccaacggaaac
ctcatcagctacaataagtttgtgcagagctgcatcgactggaaccgggaggtgctgaag
cgggagctgggcctggccgagcgggacatcgtggacatcccgcagctcttcaagatggag
aggaggaaggccgtggccttcttcccggacttggtgaacatgctggtgctgggccagcac
ctgggcatccccaagcccttcgggcccgtcatcaatggccgctgctgcctggaggagaag
gtgcggtccctgctggagccgctgggtctccactgcaccttcatcgacgacttcaccccg
taccacatgctgcactggaacgtgcactgcggcaccaacgtgcgccggcagcccttctcc
ttcaagtggtggcacatggagccctga

DBGET integrated database retrieval system