KEGG   Bos mutus (wild yak): 102277999Help
Entry
102277999         CDS       T02919                                 

Gene name
PADI2
Definition
peptidyl arginine deiminase, type II
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102277999 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 640 aa AA seqDB search
MCTQPQDRPGRQICPVRLTPPTTQSCRGAARGRETPDPPGSTFMSFAICTASARVSIQQC
GVEAGGWLRSPSCPLPTLSGQPSSSPTCLSPEISLDVDADRDGVVEKNNPRKASWTWGPE
GQGAILLVNCDRDTPWLPQEDCSDEKVYSKEDLKDMSQMILRTKGPEHLPAGYEIVLYIS
MSDSDKVGVFCVENPFFGQRYVHILGRRKLYHVVKYTGGSAELLFFVEGLRFPDEGFAGL
VSIHVSLLEYMAEEIPLTPVFTDTVTFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVK
NLVEKTNCELKVCFQYMNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKQL
LGPDFGYVTREPLFETVTSLDSFGNLEVSPPVTVDGKTYPLGRILIGSSFPLSGGRRMTR
VVRDFLQAQQVQVPVELYSDWLTVGHVDEFVTFVPIPGTKKFRMLMASTSACYKLFREKQ
KEGHGEAIMFKGLGGMSSKRITINKILSNESLVQENQYFQRCLDWNRDILKKELGLTEQD
IIDLPALFKMDKNRQARAFFPNMVNMIVLDKDLGIPKPFGPQVEEVCCLETHVRCLLEPL
GLCCTFVDDISAYHKFLGEVHCGTNVRRKPFAFKWWHMEP
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacacagccccaggacaggccaggaaggcagatctgcccagtgcggctcaccccg
cccaccacccagagctgtagaggagcagcaaggggtcgggagaccccagacccacccggc
agcaccttcatgagtttcgcaatctgcacggcgtccgctcgtgtctccatccagcagtgt
ggtgttgaggcagggggttggctaaggtccccctcctgccccctccccaccctctctggc
cagcccagcagctcacccacctgtctgtccccagagatctccctggatgtggatgcagac
cgcgacggcgtggtggagaagaacaacccaagaaaggcatcctggacctggggccctgag
ggccagggcgccatcctgctggtgaactgtgaccgagacacaccctggttgccccaggag
gactgcagtgatgagaaggtctatagcaaggaagacctgaaggacatgtcccagatgatc
ctgcggaccaaaggccctgagcacctccctgccggctacgagatcgtcctctacatctcc
atgtcggactcggacaaagtgggcgtgttctgcgtggagaacccctttttcggccagcgt
tacgtccacatcctgggccggcggaagctctaccacgtggtcaagtacacgggcggctcc
gcggagctgctgttcttcgtggaaggcctgcgttttcccgacgagggcttcgcgggcctg
gtctccatccacgtcagcctgctggagtacatggccgaggagatccctctgacgcccgtc
ttcacggacaccgtgacgttccgcatcgctccgtggatcatgacccccaacatcctgcct
cccgtgtcggtatttgtgtgctgcatgaaggacaactacctgttcctgaaagaggtgaag
aacctggtggagaaaaccaactgcgaactgaaggtctgcttccagtacatgaaccgggga
gaccgctggatccaggatgaaatcgagtttggctacatcgaggccccgcacaaaggcttc
cccgtggtgctggactcccccagagacggaaacctgaaggatttcccggtgaagcagctc
ctgggcccagactttggctatgtaacccgggagccactctttgagactgttaccagcctg
gattccttcgggaacctggaggtcagtccgccagtgaccgtggatggcaagacatacccg
ctgggccggatcctcatcgggagcagcttccctctgtccggtggtcggaggatgaccagg
gtggtgcgggacttcctgcaggcccagcaggtccaggtgcccgtggagctctactcagac
tggctgaccgtgggccacgtggatgagttcgtgaccttcgtccccatcccaggcaccaag
aaattccggatgctcatggccagcacctcagcctgctacaagctcttcagagagaagcag
aaggagggccacggggaggccatcatgttcaaaggcctgggcgggatgagcagcaagcgc
atcaccatcaacaagattctgtccaatgagagcctcgtgcaggagaaccagtacttccag
cgctgcctggactggaaccgcgacatccttaagaaggagctgggactgacggagcaggac
atcatcgacctgcccgccctgttcaagatggacaagaaccgccaggccagggccttcttc
ccaaacatggtgaacatgatcgtgctcgacaaggacctgggcatccccaagccgtttggg
ccgcaggtggaggaggtgtgctgcctggagacgcacgtgcgctgcctgctggagcccctg
ggtctctgctgcaccttcgtggacgacatctccgcctaccacaagttcctgggcgaggtg
cactgcggcaccaacgtgcgccggaagcccttcgccttcaagtggtggcacatggagccc
tga

DBGET integrated database retrieval system