KEGG   Bos mutus (wild yak): 102278212Help
Entry
102278212         CDS       T02919                                 

Gene name
MAOA
Definition
(RefSeq) monoamine oxidase A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00260  Glycine, serine and threonine metabolism
bom00330  Arginine and proline metabolism
bom00340  Histidine metabolism
bom00350  Tyrosine metabolism
bom00360  Phenylalanine metabolism
bom00380  Tryptophan metabolism
bom00982  Drug metabolism - cytochrome P450
bom01100  Metabolic pathways
bom04726  Serotonergic synapse
bom04728  Dopaminergic synapse
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
Module
bom_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102278212 (MAOA)
   00330 Arginine and proline metabolism
    102278212 (MAOA)
   00340 Histidine metabolism
    102278212 (MAOA)
   00350 Tyrosine metabolism
    102278212 (MAOA)
   00360 Phenylalanine metabolism
    102278212 (MAOA)
   00380 Tryptophan metabolism
    102278212 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102278212 (MAOA)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102278212 (MAOA)
   04726 Serotonergic synapse
    102278212 (MAOA)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    102278212 (MAOA)
   05031 Amphetamine addiction
    102278212 (MAOA)
   05034 Alcoholism
    102278212 (MAOA)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102278212 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_binding_2 Pyr_redox_2 FAD_binding_3 HI0933_like FAD_oxidored Pyr_redox Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl GIDA NAD_binding_9 3HCDH_N Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 102278212
NCBI-ProteinID: XP_005891579
UniProt: L8IW67
Position
Un
AA seq 527 aa AA seqDB search
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAVEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSERIMQLLGDRVKL
RSPVTYVDQSSENITVETLNRELYECRYVISAIPPTLTAKIHFRPELPSERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKVHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLSAKDIWIQEPEAED
VPAVEITPSFWERNLPSVSGLLKIVGFSTSITALWFVMYRFRLLSRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagagtctgcagaagacgagtgacgcgggccagatgttcgacgtagtcgtgatagga
ggcggcatctcaggattatctgctgccaaactcttagccgaacatgaagttaatgttttg
gttttagaagcccgggagagagttggaggaagaacatacacagtgaggaatgaacatgtt
gactacgtagatgttggcggtgcttatgtaggcccgacccagaataggatcttacggtta
tctaagcaactgggtttagaaacttacaaagtgaatgtaaacgagcgtcttgttcattat
gtcaagggaaaaacttatccatttcggggtgccttccctccagtatggaatcccattgct
tatctggattacaacaacctgtggcggaccatggataacatgggaaaagagattccagct
gatgcaccatgggaggccccacatgcagtggaatgggataagatgactatgaaagatctc
atcgaaaaaatctgctggacaaagactgctcggcagtttgcatctctctttgtgaatatc
aatgtgacctctgaaccccatgaggtgtctgccctgtggttcttgtggtacgtgaaacaa
tgtgggggcacaactcggatattctccattaccaacggtggccaggaacggaagtttgta
ggtggatctggtcaagtaagcgaacggataatgcaactcctaggggacagggtgaaactg
aggagccctgtcacctatgttgaccagtcaagtgaaaacatcaccgtagagaccctgaat
cgtgaactttatgagtgccggtatgtcattagtgccatcccaccaactttgaccgccaag
atacactttagaccagagcttccatcagagcgaaaccagctgatacagcgtcttccaatg
ggggctgtcattaagtgcatgatgtattacaaggaggccttttggaagaaaaaggattac
tgtggctgtatgatcatcgaagatgaggaagctccaatttcaataacactggatgatacc
aagccagatggatcactgcctgctatcatgggcttcatcctcgctcgaaaagctgaccgc
ctcgctaaagtgcataaagatataaggaaaagaaaaatctgtgaactgtacgccaaagtg
ctaggatctcaagaagctttacatccagtgcactatgaagagaagaactggtgtcaggag
cagtactccggaggctgctacactgcctacttccccccggggatcatgactcaatacgga
agggttattcgccaacctgtaggcaggatttactttgctggcacggagactgccacacaa
tggagcggttatatggaaggagcagtagaggctggtgaacgggcagctagagaggttttg
aatgctttggggaagctgtctgccaaagatatctggatccaagaacctgaagctgaagat
gttccagctgtagagatcacccccagcttctgggagagaaacctgccttccgtatcaggc
ctgctgaagattgttgggttttccacatcgataactgccctgtggtttgtgatgtacaga
ttcaggctgctaagccgatcctga

DBGET integrated database retrieval system