KEGG   Bos mutus (wild yak): 102278981Help
Entry
102278981         CDS       T02919                                 

Gene name
TGM5
Definition
transglutaminase 5
Orthology
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
bom  Bos mutus (wild yak)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 595 aa AA seqDB search
MAEGLEVALTDLQSSWNNVQHHTDEISSSRLLVRRGQAFNITLYFRNRAFQPGLDNIIFV
TETGPLPDLSKGTRAVFSLEGHPGSSPWIASLQTIGANSLEVSLCAPPMAAVGRYLLKVH
IKSLQGPVTAYQLGEFILLFNPWCPEDAVYLESEPQRQEYVMNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYISRVVSAMINSNDDNGVLNG
NWGENYSDGTNPTEWMGSVAILKQWHATGCQPVRYGQCWVFAAVTCTVMRCLGIPTRVIT
NFNSGHDTDGNLIIDEYYDNTGRILENKKKDSVWNFHVWNECWMARNDLPPGFGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMAWLVFGGKEQKLHQDT
STVGNFISTKSIQSDERDDITENYKYREAKTYPCKITYSQYSQYLSTDKLIRISALGEEK
NSPEKILVKKIITLAYPSIVINVLGAAIVNQPLSIQVVFSNPLSEQVEDCVLTVEGSGLF
RRQQRVLIGVLKPHHRASLTLETIPFKSGQRQIQANLRSNKFKDIKGYTNVYIGL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagggctggaggtggccctcaccgacctccagagctcctggaacaatgtgcag
caccatacagacgagatcagctccagtcgcctccttgttcgccggggccaggccttcaac
atcactctgtacttcaggaaccgggccttccagccaggcctggacaacatcatctttgtg
actgagactggaccactgccagatctgtccaaggggactcgagccgtgttcagcctggaa
ggtcaccctggctccagcccctggattgcttcactgcagaccattggggccaattccctg
gaggtgagcctgtgtgcccctcctatggcagctgtgggtcggtacctcttgaaggttcac
atcaaatccctacaggggcctgtcacagcctaccagctcggggagttcatcctgctcttc
aatccctggtgcccagaggatgctgtctacctggagagtgaaccccagaggcaggaatat
gtcatgaatgattatggcttcatctatcaagggaacaagaactggatccgcccctgcccc
tggaattatggacaatttgaagagaatatcatagacatctgtctggagctgctagacaag
agcctgaacttccagattgacccagccacagactgtgccctacggggcagcccggtctac
atcagcagagtggtgtccgccatgatcaacagcaacgatgacaatggggtgctcaatgga
aactggggcgagaattattcagatggcaccaaccccacagagtggatgggcagcgtggcc
atcctgaagcagtggcatgccacgggctgccagccagtgcgttacgggcagtgctgggtc
tttgctgctgtcacatgcacagtgatgaggtgtctggggatccccacccgagtgatcacc
aacttcaactctggccacgacacagacggaaacctgatcattgatgagtattatgacaac
acaggcaggattttggagaataagaagaaggacagtgtctggaatttccatgtctggaat
gaatgctggatggcacggaacgacctcccacctggattcggaggctggcaggtgctggac
gctacacctcaggagacaagcaatggcctctactgctgcggccctgcctctgtcagagcc
atcaaagaaggagaggtggatctgaactacgacacagccttcgccttttccatggtgaat
gctgactgtatggcctggctggtctttggagggaaggagcagaaacttcaccaggacacc
agtactgttggtaattttattagcaccaagagcatccagagtgatgagcgggatgacatc
acggaaaactacaagtatagagaagcaaagacctatccctgcaaaatcacctattcccag
tacagccagtacctgtccacagacaagctgatccgcatcagtgccctgggtgaagagaag
aacagtcctgaaaagatcctggtgaagaagatcatcaccttagcctatcccagcatcgtg
attaatgttttaggagcagccattgtgaaccagccgctctctatacaggtggtattttca
aaccccctctcggagcaggttgaagactgtgtgctgactgtggaaggaagtggtctcttc
aggagacagcagagagtcctcattggagtcctcaaaccccatcacagagccagtctcact
ctggagactatccccttcaagagtggccaaaggcaaatccaagcgaatctgaggagcaac
aaatttaaggacatcaagggttacacgaatgtctatattgggttataa

DBGET integrated database retrieval system