KEGG   Bos mutus (wild yak): 102278988Help
Entry
102278988         CDS       T02919                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00500  Starch and sucrose metabolism
bom01100  Metabolic pathways
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04910  Insulin signaling pathway
bom04922  Glucagon signaling pathway
bom04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102278988 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102278988 (GYS1)
   04152 AMPK signaling pathway
    102278988 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102278988 (GYS1)
   04922 Glucagon signaling pathway
    102278988 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102278988 (GYS1)
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102278988 (GYS1)
Glycosyltransferases [BR:bom01003]
 Polysaccharide
  Storage polysaccharide
   102278988 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102278988
NCBI-ProteinID: XP_005895430
Position
Un
AA seq 736 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSGADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEYFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDLPPDEDDERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGSKRGSVDTAPSSSVST
PSEPLSPASSLGEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctccctgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcgggatctacacagtgctgcagacgaaggcaaaggtgacgggggacgagtggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaacccccgaccccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtacttcgggcgctggctgattgaggggggccccctggtggtgctcctcgatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacatgcaacatcggg
gtgccctggtacgaccgggaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacacgtggtcgcacacttccac
gagtggttggcaggtgtcgggctctgcctgtgccgcgcccggcggctgcccgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgctggggctgtggacttc
tacaacaacctggagaatttcaacgtggacaaagaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggccgcagcccactgcgctcatgtcttcactactgtgtcccag
attaccgccattgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctagacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggggccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagtgagcag
acggtggtcgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctt
aagggccaggccgtgcgcaagcagctttgggatacggccaacacagtgaaggaaaagttt
gggaggaagctttacgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagctatctttgccacacagcggcaatctttc
cctcctgtgtgcacccacaatatgctggatgactcctcagaccccatcttgacaaccatc
cgccgaatcggcctctttaatagtggtgctgacagagtcaaggtgatttttcacccggag
ttcctgtcttctacgagccctctgctccctgtggactatgaggaatttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacaccagctgaatgcacg
gtaatgggtatccccagtgtctccaccaacctctccggattcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctggaccggcgattccgcagtctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccgaagg
cagcgcattatccagcggaaccgaacggagcgcctctctgaccttctggactggaaatac
ctaggccggtactacatgtcagcgcgccacatggcgctggccaaggcctttccagaatac
ttcacctacgagcctcacgaggctgacgcgacccagggctaccgctacccacggccagcc
tcagtgccaccatcaccctcgctgtcgcgacactccagcccgcaccagagcgaggatgag
gaggaaccccgggacttaccacctgatgaagatgacgagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgcccccgagtggccacgccgcgcctcctgcacc
tcttccaccgggagcaagcgtgggtctgtggacacagcgccctccagctcagtcagcacc
cccagcgaaccccttagccccgccagctccctgggcgaggaacgcaactaa

DBGET integrated database retrieval system