KEGG   Bos mutus (wild yak): 102279438Help
Entry
102279438         CDS       T02919                                 

Gene name
NEU1
Definition
sialidase 1 (lysosomal sialidase)
Orthology
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
bom  Bos mutus (wild yak)
Pathway
Other glycan degradation
Sphingolipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bom00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bom00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bom04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 415 aa AA seqDB search
MTEEGPGIVSLGKLRRPRMLRLWGICRVQIFSAIFMLMSPAGVGARAKDDFSLVHPLVTM
EQLLWVSGKQIGSVDTFRIPLITTTPRGTLLAFAEARKMSTSDKGAKFIALRRSMDQGST
WSPTAFIVDDGETPDGLNLGAVVSDTTTGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVS
WSSPRNLSLDIGTEMFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGVSW
RYGGGVSGIPYGQPKRENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIIIRSYDACD
TLRPRDVTFDTELVDPVVAAGAVATSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
VQLWPGPSGYSSLTTLEGNVDGKDEAPQLYVLYEKGRNQYMESISLVKVSVYGTL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagagggacccggtatagtgtccttgggcaaactcaggagaccgcgaatgctg
cgattatggggaatctgtagggttcagatattttccgcgatcttcatgctaatgtctcct
gcaggagtcggggccagagcaaaggatgacttcagtctggttcatccacttgtgaccatg
gaacaacttctgtgggtgagtgggaagcaaatcggctccgtggacactttccgaatcccg
ctcatcaccaccactcctcggggcactctccttgcctttgctgaggccagaaaaatgtcg
acatcggataaaggagctaaattcatagctctgcggaggtctatggaccagggcagcaca
tggtctccgacagctttcattgtggatgatggggagaccccagatgggctgaacttgggg
gcagtggtgagcgacacgacgacaggcgtggtcttccttttctactccctctgtgctcat
aaggctggctgccaggtggcctctaccatgctggtgtggagtaaggatgatggtgtttcc
tggagctcgccgcggaacctctccctggatataggcaccgagatgtttgccccaggaccg
ggctctggcattcagaaacagcgggagcctcggaagggccgacttatcgtgtgtggccac
ggaacgctggagcgggatggggttttctgcctgctcagcgatgatcacggcgtctcctgg
cgctacggaggtggggtcagtggcatcccctacggccagcccaagcgggaaaatgacttc
aaccccgatgagtgccagccctacgagctccccgatggctcagtcgtcatcaacgcgcgg
aaccaaaacaactaccactgccattgccgcatcatcatccgcagctacgacgcctgtgac
accctgaggcctcgggatgtgacctttgacacggagctcgtggaccctgtggtagctgca
ggggctgtagccaccagctctggcattgtcttcttctccaacccagcccatccagagttc
cgagtaaacctgaccctgcgctggagcttcagcaatggtacctcctggaggaaggagacg
gtccagctgtggccggggcccagtggctattcatcgctgaccaccctggagggcaacgtg
gatgggaaggatgaggccccacagctctacgtcctgtatgagaaaggccggaaccagtac
atggagagcatctctctggtcaaagtcagcgtctacggaacactgtga

DBGET integrated database retrieval system