KEGG   Bos mutus (wild yak): 102279527Help
Entry
102279527         CDS       T02919                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
bom  Bos mutus (wild yak)
Pathway
Endocrine resistance
Estrogen signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    102279527 (NCOA3)
   04919 Thyroid hormone signaling pathway
    102279527 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102279527 (NCOA3)
   05224 Breast cancer
    102279527 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    102279527 (NCOA3)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102279527 (NCOA3)
Chromosome [BR:bom03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102279527 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1412 aa AA seqDB search
MSGLGENALDPLAPDSRKRKLPCDPPGQGLACSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAITSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNREGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVTWTNETQRQKSHTFNCRMLMKIPHDILEDINTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSSPESFITRHDLSGKVITIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPLYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPNPVGQGIRPPAAGCNNSVGGMSMSPNPGLQMLSSRTYGL
TDPGTAGQMSGARYGASGSIASMNPGPGMQSPSSYQNSTYGLNMSSPPHGSPGLGSSQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTVSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNITQPSKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHINDKESK
ESGVEGSENQRAPLESKGHKKLLQLLTCSSDDRGHSCLTNSPLDSSCKDSSISVSSPSGV
SSSTSGGVSSTSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCVEG
NVKQEQLSPKKKESNALLRYLLDRDDPSDTLAKELQPKVEGVDSKMSQCSSSAIPSSSQE
KDAKIKTETNEEGSGDLDNLDAILGDLTNSDFYNNSIPTSGSNLGTKPQMFQGANSLGLR
SPQPVQSVRPPYNRAVSLDSPVSVGSSPPVKNIGAFPMLPKQPMLGGNPRMMDNQENYGS
NMGGPNRNVTVNQAPSSGDWGLPSSKASRMEPVNSNAMGRPGTDYNASLPRPAMGGSMPA
MPLRSNSIPGARPVMQQQQHQQPQPQMLQMRPGEIPMGMGVSPYGQAAPSNQPGSWPDGM
LSMEQGPHGTQNRPILRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDR
ALGNIPELVNQGQALEPKQDAFQGQEAAVMMEQKAALYGQTYPGQGPPMQGGFNLQGQSP
PFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEM
KMENPTAGGATAMRPMMQPQVNSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQ
QQQQTQAFSPPPNVTASPSMDGVLAGPAMPQAPPQQFPYPSNYGMGQQPDPAFGRVPSPP
NAMMSSRMGPSQNPMMQHPQTAPMYQSSEMKGWPSGTLARNSTFPQQQFAHQGNPAAYSM
VHMNGSGGPMGQMNMNAMPMAGMPMGPDQKYC
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggttaggagaaaacgccttggatccactggcccctgattcacgaaaacgcaag
ttgccatgtgatcctccagggcaaggccttgcctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaattggctgaactaatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctattaccagtgatgatgatgttcagaaagctgat
gtatcttccacaggacaaggagttattgataaagactccttaggaccactcttacttcag
gcattggacggcttcctatttgtggtgaatcgtgaaggaaacattgtatttgtgtcagaa
aatgttacccagtacctacaatataagcaagaggacctggttaatacaagtgtctacaat
atattgcatgaagaagatagaaaggattttcttaaaaacttaccaaaatctacagttaat
ggagttacctggacaaatgagacccagagacaaaaaagccatacatttaactgccgtatg
ttgatgaaaataccacatgacattctggaagacataaacaccagtcccgaaatgcgccag
agatacgagacgatgcagtgctttgccctgtcccagccgcgggctatgatggaggaaggg
gaagacttgcagtcctgtatgatctgtgtggcacgccgcattaccactggagaaagagca
tttccatcaagtcctgagagctttatcactagacacgatctttcagggaaagttattact
atagacaccaattcactgagatcctccatgagacctggctttgaagacataatccgaagg
tgtatccagagattttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccatgcagaaaccccgctgtatcgattctctttggctgat
ggcactatagtgactgcgcaaacaaaaagcaaactattccgaaatcctgtaacaaatgac
cgtcatggctttgtctcaacccactttcttcagagggaacagaatgggtatagaccaaac
ccgaatcctgttggacaaggcattaggcctccagcagctggatgcaacaattcagtaggc
ggcatgagtatgtcaccaaatccaggcttacagatgctgagcagcaggacttacggctta
actgatcctggcaccgcggggcagatgagtggagccaggtatggggcttccggtagcata
gcctccatgaaccccgggccaggcatgcagtcaccatcttcctaccagaacagtacctac
ggtctcaacatgagtagccctccacacgggagccctggtctcggctccagccagcagaat
atcatgatttctcctcgtaatcgagggagtccaaagatggcctcacaccagttttctcct
gttgcaggcgtgcactctcccatgggatcttctggcaataccgtgagtcacagcttttct
agcagctctctgagtgcccttcaagctatcagtgagggcgtggggacttctcttttatct
acactgtcttcgccaggtcccaaattggataattcccctaatatgaatataactcaacca
agtaaagtgaacagtcaggattccaagagtcccctaggcttgtattgcgaccagaatcca
gtggagagttcaatgtgtcagtcaaatagcagagatcacattaacgacaaagaaagtaag
gagagcggtgtggaagggtctgagaatcagcgggctcctctggaaagcaaaggtcacaaa
aagttgctgcagttactcacctgttcttctgatgaccggggtcactcctgcttgaccaac
tcccccctggactcaagttgtaaagactcctccattagtgtcagcagcccctctggggtc
tcctcttccacctccggaggcgtatcctccacatccaacgtgcatgggtcactgctgcaa
gagaagcaccggattttgcacaagttgctccagaatggaaattcaccagcagaagtagcc
aagattaccgctgaagccactgggaaggacaccagcagtacgacgtcttgtgtagaagga
aacgtcaagcaggagcaactcagtcctaagaaaaaggaaagtaatgctctgcttaggtat
ctgctggacagggacgatcctagtgacacacttgccaaagagctccagcccaaagtggaa
ggcgtggacagtaagatgagtcagtgcagcagctccgccattccgagctcgagtcaagag
aaagatgctaaaattaagacagaaacaaatgaagagggatccggagacttggataatcta
gatgctattcttggtgatctgactaattctgacttctacaataattccatacccacaagt
ggtagtaacctgggaactaagccacagatgtttcaaggagctaattctctgggtttgagg
agtccgcagcctgtacagtctgtccgtcctccgtataaccgggcagtatctctagacagt
cctgtttccgttggctcaagtcctccagtaaagaatattggtgctttccccatgttacca
aagcaacccatgttgggcggcaatccaagaatgatggataatcaggaaaattacggctca
aatatgggtgggccaaacagaaatgtgactgtgaatcaggcgccttcctcaggagattgg
ggcttaccgagctccaaggccagccgcatggaacctgtgaattcaaatgccatggggaga
ccaggaactgattataatgcttctttacccagacctgccatgggcggctcgatgcccgcc
atgccacttcggtccaatagcatcccaggtgcgagaccagtgatgcagcagcagcagcat
cagcagccacagccacagatgcttcagatgcggcctggtgagattcccatggggatgggg
gtcagtccttatggccaagcagcaccatcaaaccaacctggttcctggccagatggcatg
ttgtccatggaacaaggccctcatgggacccaaaataggccaattcttaggaattccctg
gatgatctccttgggccaccttctaacctagaaggccagagtgatgaaagagcactgttg
gaccagttgcacacactcttgagcaacacagatgccacaggcctggaagagattgacaga
gctctgggcaacattcctgaacttgtaaatcagggacaagcgttggagcccaaacaggac
gctttccaaggccaagaagcagcagtaatgatggagcagaaggcagcattatacgggcag
acatacccggggcaggggcctccgatgcaaggaggctttaatcttcagggacagtcacca
ccttttaactcgatgatgaatcagatgaaccagcaaggcaattttcctctccaaggaatg
cacccccgggccaacatcatgagaccccggacaaacactcccaagcaacttagaatgcag
cttcagcagaggctgcagggccagcagtttttgaatcagagccgtcaggcacttgaaatg
aaaatggaaaaccccactgctggcggggcgacggcgatgaggcccatgatgcagccgcag
gtcaactcccagcagggtttccttaacgctcagatggttgcccagcgcagcagagagctg
ctgagtcatcacttccggcagcagagggtggcgatgatgatgcaacagcagcagcaacag
cagcagcagcaaacccaggccttcagtccacccccgaatgtgactgcgtcccctagcatg
gatggggtcctggctgggcctgccatgccacaagctccaccccagcagtttccataccct
tcaaattacgggatgggacaacaaccagatccagcctttggtcgagtgcctagtcctccc
aatgcgatgatgtcatcaagaatgggtccctcccagaatcccatgatgcagcatcctcag
accgcacccatgtatcagtcatcagaaatgaagggctggccatcaggaaccctggcccgg
aacagcacctttccccagcagcagtttgcccaccaggggaatcctgcagcgtacagtatg
gtgcacatgaacggcagcggtggtcccatgggacagatgaacatgaacgccatgcccatg
gctggcatgcccatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system