KEGG   Bos mutus (wild yak): 102279541Help
Entry
102279541         CDS       T02919                                 

Gene name
SPACA5
Definition
sperm acrosome associated 5
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102279541 (SPACA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 156 aa AA seqDB search
MQVSGTIVVILMAANVEAKIYERCDLAKKLEAAGLNGFKGYTIGDWLCMAHYESGFDTSF
VNHNPDGSSEYGIFQLNSAWWCYNGVTPSENLCHMDCHELLNRHILDDIMCAKKVVSSES
GMSAWDSWNQHCYGYDLSEWLRGCHMNAKPNKKIIS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctcaggcactattgtggtgatcctgatggctgccaacgtggaggccaagatc
tacgaacgctgtgacctggcaaagaagctggaagcagcaggcctcaacggcttcaagggc
tataccattggagactggctgtgcatggcacactatgagagtggctttgacacttccttc
gtgaaccacaatcccgatggcagcagtgaatatggcatttttcagctgaattccgcctgg
tggtgttacaatggtgttacacccagcgagaacctctgccacatggattgtcatgaactg
ctcaaccgccatattctggatgacattatgtgtgccaagaaggtagtgtcctcagagagt
ggcatgagtgcttgggattcttggaaccaacactgttatggctatgatttatctgaatgg
ctcaggggatgtcatatgaatgcaaaacctaacaaaaaaattatttcatga

DBGET integrated database retrieval system