KEGG   Bos mutus (wild yak): 102279725Help
Entry
102279725         CDS       T02919                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
bom  Bos mutus (wild yak)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102279725 (POMT2)
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     102279725 (POMT2)
Glycosyltransferases [BR:bom01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102279725 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 669 aa AA seqDB search
MYWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFLFQKPGDNYEHHSY
MGMRGFCAFLGSMLIPLAYLTVLELSRSLSAALLTAALLTFDTGCLTLSQYILLDPILMF
FIMAAMLSMVKYNSCANRPFSAPWWFWLSLTGVNLAGALGVKFVGLFIILQVGWNTLSDL
WHLFGDLSLSMVTLGKHLTARILCLIVLPLALYIATYAVHFMVLNKSGPGDGFFSSAFQA
RLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRHFYPEGVGARQQQVSGHLHKDY
NNLWIIKKHNSNSDPLDPSLPVEFVRHGDIIRLEHKETSRNLHSHYHEAPLTRKHYQVTG
YGINGSGDSNDFWRIEVINRKFGNRIKVLRSQIRLIHLITGCVLGSSGKVLPKWGWEQME
VTCTPYLKETLSSIWNVEDHINPKLPNISLEVLQPSFPEIMLESHMVMIRGNNGLKPKDN
EFTSKPWHWPINFQGLRFSGANDTDFRVYLLGNPVVWWLNLLSIALYVLSASVFAVAVQR
GAHLPVEVEGLSQVLLQGGGQLLFGWMMHYFPFFLMGRVLYFHHYFPAMLFSSMLTGLLW
DTLLRLCAWSLASYPLARCVHVLGILSLLLGTAYSFYLFHPLAYGMVGPLAQDPRSPMAG
LRWLESWDF
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtattgggatgagactcactttggaaaaatgggaagttactatatcaatcgcaccttc
ttctttgatgtgcacccacctctgggaaagatgctgattggtctggctggctacctgagc
gggtacgatggcacctttttgttccagaagcctggggacaactatgagcatcacagctac
atgggaatgagaggattctgtgcattcctcggctccatgctcatccccttggcctacctc
accgtgctggagctgtcccggtctctctcagcagcgctgctcacggccgccctcctcacc
tttgacacaggatgcctcactctgtcccagtacatcctccttgaccccatcttgatgttc
ttcatcatggctgccatgctgagcatggtcaagtacaactcctgtgccaacaggcccttc
tctgccccctggtggttctggctcagcctgaccggcgttaatctggctggcgctctgggg
gtcaagtttgttggcctcttcatcatcctgcaagtggggtggaacaccctttcagacctt
tggcacctgtttggagacctcagtctttcaatggtgaccttgggaaaacacctgaccgct
cgcatcctgtgcctcatagtgctgccactggctctctacattgccacctacgctgtccac
ttcatggtgctgaacaaaagcggtcccggtgatggcttcttcagttctgccttccaggcc
cggctttcaggaaacaaccttcacaacgcgtccatccccgaacacctggcctacggctcc
gtgatcactgtgaagaacctgcggatggccatcggctacctccactcgcacaggcacttc
taccccgagggcgtcggagcccgccagcagcaggtcagtggccatttgcacaaggactac
aacaacctgtggattattaagaagcataattcgaactcagatcccctagacccttcactc
ccagtggagtttgtgagacatggagacatcattcgactagaacacaaagagacttctcgg
aacttgcacagtcactatcacgaggcccccctgacccggaagcactatcaggtcactggc
tatggcataaatgggtcaggggactcgaatgacttctggcggattgaggttataaacaga
aaatttggaaaccgaatcaaagtgctgagaagtcaaattcgcctcatccatctgatcaca
ggttgtgtcctgggctcctcgggaaaggtcctgcccaagtggggctgggagcagatggaa
gtcacatgcacaccatacctgaaggaaaccctcagctccatctggaacgtggaggaccat
atcaatcccaaattgccaaacatcagcctggaagtgctgcagcccagtttccctgagata
atgctggagtcccacatggtgatgatccgggggaacaatggcctcaagcccaaggacaat
gagttcacgtccaaaccctggcactggcctatcaactttcagggcctgcgcttctcaggg
gccaatgacaccgacttccgagtgtatctactgggcaacccggtagtctggtggctgaac
ctgctgagcatcgccctctacgtcctctcagcgagcgtctttgctgtggctgtgcagagg
ggcgcgcatctgcctgtcgaggttgaagggctgtcccaggtcctgctgcaaggaggcggg
cagctcctgttcggctggatgatgcattacttccccttcttcctgatgggccgggtcctc
tacttccaccactacttccccgccatgctcttctccagcatgctcacaggccttctgtgg
gacaccctcctgcggctctgtgcctggagcctggcctcctatccgctggccagatgcgtg
cacgtgctgggcatcctgagcctgctcctgggaactgcctacagtttctacctcttccac
cctctggcttacgggatggtaggtcccctggcccaggacccccgaagtccgatggccggg
ctcaggtggctggaatcgtgggacttttga

DBGET integrated database retrieval system