KEGG   Bos mutus (wild yak): 102282379Help
Entry
102282379         CDS       T02919                                 

Definition
UDP-glucuronosyltransferase 2C1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bom  Bos mutus (wild yak)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102282379
   00053 Ascorbate and aldarate metabolism
    102282379
   00500 Starch and sucrose metabolism
    102282379
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102282379
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102282379
   00860 Porphyrin and chlorophyll metabolism
    102282379
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102282379
   00982 Drug metabolism - cytochrome P450
    102282379
   00983 Drug metabolism - other enzymes
    102282379
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102282379
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102282379
Glycosyltransferases [BR:bom01003]
 Others
  Hydrophobic molecule
   102282379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 529 aa AA seqDB search
MKTVKGFYVLFMLHLWFFDSGRTGKILVWPMDFSHWINLKIILDELHLGGHEITVLIPST
SSLLDHTQIPFNVEILESPISKESFMEEFTANLYTLSFELPKVSWWERQVRLTKMLKEFL
ATTRSICDSVVTNKELLTRLQAAKFDICIADPLSFCGELVAELLNIPFIYSFRFSYGNVI
ERLCAGLPMPSSYVPGAVSGLTDSMTFIQRLENWLSYTINDLMYSYFVFPEWDEYYSKVL
GKSTKLCEIMGKAEMWLIRTSWDFEFPHPFLPNFEFVGGLHCKPAKPLPKEFEEFVQSSG
KNGVVVFTLGSMVKNLTEENSKMIASALAQIPQKVLWKYGGKKPENLGANTRIYEWIPQN
DLLGHPQTRAFITHCGTNGVYEAIYHGVPMVGIPLFGDQYGNVARVKAKGAAVELDLQRM
TSSDLLNALKAVINNPIYKENAMKLSRIHHDTPVKPLKRAVFWIEFIMRHKGAKHLRPAF
HDLTWYQHHSLDVIGFLLACVATIIFLVTKCCLFCCGKFGKISKKKKRE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgtgaaaggcttctatgtccttttcatgctgcatctatggttctttgactct
ggaaggaccggaaagatacttgtatggcccatggatttcagtcactggattaatttaaag
attattctggatgaactccaccttggtgggcatgagataactgtcctcataccttcaaca
agttctctgcttgatcatacccagattccctttaacgtggagatccttgaaagtccaata
agtaaagaaagtttcatggaagaattcactgctaatctctacacactttcttttgaactg
ccgaaagtttcatggtgggagaggcaagtacgactgacaaaaatgttgaaagagttttta
gcaacaaccagaagcatttgtgacagtgttgtcacaaacaaggagttgctcaccaggctt
caggcagctaagtttgatatctgtattgctgaccctttaagcttctgtggggagttagtg
gctgagcttctcaacattccatttatatactcctttcggttttcctatgggaatgtcatt
gagagattgtgtgctgggcttcctatgccttcttcatatgttcctggagccgtatcagga
ctgacagacagcatgacttttatacagaggctggagaactggttatcgtatacaataaat
gacctgatgtattcatattttgtatttccagaatgggatgaatattacagcaaggtttta
ggaaaatctaccaaattatgtgagattatgggaaaagctgaaatgtggttgattcgaact
agctgggattttgaatttcctcaccctttcttacctaactttgaatttgttggaggactg
cattgcaagcctgcaaaacccttgcctaaggagtttgaagagtttgttcaaagttctgga
aaaaatggagtcgtggtgtttactctgggatcaatggtcaaaaacctcacagaagaaaac
tctaaaatgattgcatcagcccttgcccaaattccacaaaaggttctgtggaaatatgga
ggaaagaaaccagaaaatttaggagccaatacccggatatatgaatggattccacagaat
gatcttctgggtcatccccaaaccagagcttttatcactcactgtggaaccaatggggtc
tatgaagctatctaccatggggtccctatggtgggaatccccctgtttggtgatcagtat
ggtaatgttgctcgtgttaaagccaaaggagcagctgtcgaattagacttgcaaagaatg
acgagttccgatctgcttaacgctttgaaggcagttattaacaaccctatctataaagag
aatgctatgaagttatcaagaattcaccatgatacaccagtgaagcccctcaaacgagca
gtcttctggattgagtttatcatgcgtcacaaaggagccaaacaccttcgaccagccttc
cacgacctcacctggtaccagcaccactctttggatgtgattggcttcctgctagcttgt
gtggcaactattatattcctggtcactaaatgttgcctgttttgttgtgggaagtttggc
aaaatttcaaagaagaaaaagagagagtag

DBGET integrated database retrieval system