KEGG   Bos mutus (wild yak): 102282528Help
Entry
102282528         CDS       T02919                                 

Gene name
F13A1
Definition
coagulation factor XIII, A1 polypeptide
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
bom  Bos mutus (wild yak)
Pathway
Complement and coagulation cascades
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:bom04610]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 732 aa AA seqDB search
MSESSGTAFGGRRAIPPNTSNAAENDPPTVELQGLVPRGFNPQDYLNVTNVHLFKERWDS
NKVDHHTDKYSNDKLIVRRGQSFYIQIDFNRPYDPRRDLFRVEYVIGLYPQENKGTYIPV
PLVSELQSGKWGAKVVMREDRSVRLSVQSSADCIVGKFRMYVAVWTPYGVIRTSRNPETD
TYILFNPWCEEDAVYLENEKEREECVLNDIGVIFYGDFNDIKSRSWSYGQFEDSILDACL
FVMDKANMDLSGRGNPIKVSRVGSAMINAKDDEGVIAGSWDNVYAYGVPPSAWTGSVDIL
LEYKSSQKPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQLDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLVYVTAKKDGTHVVEALDTTHIGKLIVTKEIGGDGMKDITD
TYKFQEGQEEERLALETAMMYGAKKALNTEGVLKSKSDVRMNFEVENAVLGRDLKVIITF
RNNGSARYTVTAYLSGNISFYTGVSKAEFKNETFEVTLEPLSFKREEVLIGAGEYMGQLL
EQAFLHFFVTARVNETRDVLAKQKSIALTVPKVVIKVRGAQVVGSDMVVTVEFTNPLKET
LRNVWIRLDGPGVTKPLRKMFREIRPNSTVQWEELCRPWVSGPRKLIASLTSDSLRHVYG
ELDLQIQRRPSM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagtcctccgggaccgcttttggaggcaggagagccatcccccccaacacctcc
aacgcagcagagaacgacccccccactgtggagctgcagggcctggtgccccggggcttc
aacccgcaagactaccttaatgtcacgaatgttcacctgttcaaggagaggtgggacagc
aacaaagtggatcaccataccgacaaatacagcaacgacaagctgatcgttcgtagagga
cagtctttctacattcagatcgacttcaatcgtccctatgaccccagaagggatctcttc
agggtggagtatgtcattggtctctacccccaggaaaataaaggaacctacattccagtc
cctttggtctctgagctgcagagtggcaagtggggggcgaaggtggtcatgagagaggac
aggtctgtccggctgtctgtccagtcttctgcagactgcattgtggggaagttccgcatg
tacgtggctgtctggaccccctatggggtcatccgcaccagccgaaaccccgaaacggac
acatacattctcttcaacccttggtgcgaagaggatgctgtgtatctggaaaatgaaaaa
gaaagagaagagtgcgtcctgaatgacatcggggttattttttatggagacttcaacgac
atcaagagcagaagctggagctacggtcagtttgaggatagcatccttgacgcttgcctg
tttgtgatggacaaagcgaatatggacctttccggcagagggaatcccatcaaagtcagc
cgtgttgggtctgcaatgatcaatgccaaggacgacgaaggcgtcattgctggctcctgg
gacaatgtctacgcttatggtgttcccccatcagcttggaccggaagtgttgacatcctc
ctagaatacaagagttctcagaaaccagtccgctatggtcagtgctgggtttttgctggt
gtctttaatacatttttgcgatgcctggggataccagcgcgagttgtcaccaactatttc
tcagcccatgacaatgatgccaacttgcaattggacatattcttggaagaagatgggaac
gtgaactccaaactcaccaaggattcggtgtggaattaccactgctggaatgaagcctgg
atgacgaggccggaccttcccgttgggtttggaggttggcaagtcgtggacagcaccccc
caggaaaacagcgatgggatgtatcggtgcggccccgcctctgttcaagccatcaagcat
ggccacgtctgcttccagtttgatgcaccctttgtttttgcagaggtcaacagtgacctt
gtttacgttacagctaagaaagatggcactcatgtggttgaagcccttgataccacccac
attgggaagttaattgtgaccaaagaaattggaggagatggcatgaaggacatcacggac
acctacaaattccaggaaggtcaagaagaagagaggctggccctggaaaccgccatgatg
tatggggccaaaaaggccctcaacacagagggcgtcctcaaatcgaagtctgatgtccgc
atgaacttcgaggtggagaacgccgtgctgggcagggacttgaaggtcatcatcaccttc
cggaacaatggctccgcccgctacactgtcacagcctacctctccggaaacatcagcttc
tacaccggggtctccaaggcggaattcaagaacgagaccttcgaagtgaccctggagccc
ttgtccttcaagagagaggaggtgctgatcggagcgggcgagtacatgggccagctgctg
gagcaggccttcctgcacttctttgtcacggctcgagtcaacgagaccagggacgttctg
gccaagcagaagtccattgcgctgacggtccccaaggtcgtcatcaaggtccgtggtgct
caggtcgtgggttccgacatggtggtgacggttgagttcaccaatcctttaaaagagacg
cttcgcaatgtctggatccgcctggatggtcccggagtgacgaaaccgttgaggaagatg
ttccgggaaatccggcccaactccaccgtgcagtgggaagagctgtgtcggccctgggtc
tccggcccccggaagctgatcgccagcctgaccagcgactccctgaggcacgtgtacggc
gagctggacttgcagattcagagacgaccttcgatgtag

DBGET integrated database retrieval system