KEGG   Bos mutus (wild yak): 102283706Help
Entry
102283706         CDS       T02919                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102283706 (GTF3C4)
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     102283706 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 764 aa AA seqDB search
MSTERRLRISRNPERGAARPHDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPL
HSCFLKVGSKREVAECKQRFATSEDPTVSQTFMLDRVFNPEGKALPPLRGFKYTSWSPVG
CDANGRCLLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRFSRNEAPEGSL
RDFAEFQRRHSMQAPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLP
FAGKESISSCNTIESGISSPSVLFWWEYEHNNRKMSGLIVGSAFGPVKILPVNLKAVKGY
FTLRQPVVLWKEMDQLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNV
HNSHVTGLHSLPIVSMTADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFG
SVRTHGIAVSPCGAYLAVITTEGMVNGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNL
FKQVDLIDLVRWKILKDKHIPQFLHEALEKKIESSGATYYWRFKLFLLRILYQSMQKTPS
EALCKPTHEDSKILLVDSPGMGNAEDEQQEEGTSSKQISKQSKDGDPEDPTEDSLPQSAD
TGGREPMEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMS
DEEYDDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQ
SCQSLIYRRCLLHDSIARHPIPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagagaggcgcctccggatctcgcgaaacccggagcgaggcgccgcgagaccc
cacgaccaccgcgtgtcggtgtccacggcccgcagcatcgccgtgctggaactcatctgc
gacgtgcacaacccgggccaggacctggttatccaccgcacgtcggtgcccgcgcctctc
cacagctgcttcctcaaagttggctcaaaaagggaagttgccgagtgtaaacagagattt
gccacctctgaagaccccacagtcagtcagactttcatgttggacagggtgttcaaccct
gaggggaaggctctgccaccactgagagggttcaagtacactagctggtcccctgtgggc
tgtgacgctaatggcaggtgcctgctggccgcactgaccatggacaatcgcctgaccatc
caggctaacctcaacagactgcagtgggtccagctggtggacctgacggagatttacgga
gagcgtctctatgagaccagctacaggttctccagaaacgaggccccggagggcagtctc
agggatttcgccgagtttcagaggcgacacagcatgcaggcgccggtgcgcatggagtgg
tcgggcatctgcaccacccagcaggtcaagcacaacaacgagtgccgcgacgtgggcagc
gtgctcctggcggtcctctttgagaacgggaacatcgccgtgtggcagttccagctcccc
tttgcagggaaggagtccatctcttcatgcaacaccatcgagtcaggaatcagctctcct
agcgttttgttctggtgggaatatgagcacaacaatcggaaaatgagcggccttatagtg
gggagtgcttttgggcctgtgaaaatcctgcctgtcaaccttaaagcagtcaaaggctat
ttcaccttgaggcagcctgtcgtcttgtggaaagaaatggaccagctgccagtccacagc
atcaagtgcgtgccgctgtatcacccttaccagaagtgcagctgcagcttagtggtggcc
gcacgagggtcctatgtgttttggtgtcttctcctgatctccaaagcaggtctgaatgtt
cacaactctcacgtcacaggcctgcactccctgcccatcgtctccatgactgccgacaag
cagaatggaacggtgtatacttgctccagtgacggcaaggtgaggcagctgatccccatt
ttcacagatgtggcgttgaagtttgagcaccagttgattaaactctctgatgtgtttggc
tccgtgaggacacacgggatagccgtgagcccctgcggcgcatacctggccgtcatcacc
actgagggcatggtcaacggcctccatcccgttaacaaaaactaccaggttcagttcgtt
actctcaaaacctttgaagaggcagctgctcagcttctggagtcttctgtccagaatctc
tttaagcaggtagatttaatagacctagtacgctggaagattttaaaggataagcatatc
cctcaatttttacatgaagctttggaaaaaaagatcgaaagcagtggggccacctattac
tggcgtttcaaactcttcctcctgagaattttatatcagtcgatgcagaaaaccccttca
gaagccttgtgcaaacccacccacgaggactcaaaaatcttgctagttgactcacctggg
atgggcaatgctgaggatgaacagcaggaggaaggcacctcttccaaacagattagtaag
caaagcaaagacggcgatccagaggaccccacagaggactcactccctcagtctgcggat
actggaggccgagagccaatggaagagaaactccttgaaatccagggaaaaattgaagca
gtggaaatgcacttgacgagggagcacatgaagcgagtcctgggcgaagtgtatctacac
acctggatcacagaaaacactagcatccccaccaggggactctgtaacttcctgatgtct
gatgaggagtatgatgacagaaccgcacgggtgctgattggacacatctcaaagaagatg
aacaagcagaccttccctgagcactgcagtttgtgtaaggagatcttgccgtttacagat
cgcaagcaggccgtctgctccaatggccacatctggctccggtgctttttaacctaccag
tcctgccagagtttgatatacagaaggtgtttgctccatgacagcatcgctcgccatcca
attccagaagaccctgactggatcaagaggttactgcagagcccctgccctttctgcgac
tctcctgttttctga

DBGET integrated database retrieval system