KEGG   Bos mutus (wild yak): 102284297Help
Entry
102284297         CDS       T02919                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102284297 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 2054 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTTNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLD
GKGAPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQPCTSHVLA
PGTTQKLKPPLSSLPPPTPISGQSPSSQKSSTSVPSTSPQSSSSQSSVPSFSSLTNNSQL
KALFDGLSHIYTTQGQSRQKGHPSYAPPKRMRRKTEFPLTAKSKAHFFGKRDVRSRFISH
SSSSSWGMARGRIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKISIKQESTDINVIGNKDTVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILGHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSSRANSRQSPAKVQSKNKYLHSPESRPVAGERGQLMELSKESSEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINSSVT
TETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQPGKKRQTEE
EEGKDNHCFKNTDPCRNNMDDGANNLKEASRDNPEPLKCKQWPKGTKRGLSKWRPSKERK
TGFKLNLYTPPETPMEPDDQVTVEEQKETPADKPSPSSTRTEEGLKEAVEPLLPRDENGR
EETCAPVSPNKSPAGKPEDDVLKPEEEEEEEEEEEEEGNVEKDPSGAKSQEKEEPEVCMD
KEDPVRLDDHEEEEEEEEEPSHNEGHDADDEDDSHMESAEVEKEEHPREAFKEVLENQEA
FLDLSVQPSHSNPEVLMDCGVDLPASCNSEPKELAGATETAPESDEEPPGEQAQKQDQKN
SEEVDSEFKEGNTATLEIDSETVQAVQSLTQENSEQDDTFQDCAETQEACRSLQNYTHAD
QSPQISATLDDCQQSDHSSPVSSVHSHPGQSVRSVSSPSVPALENSYAQISPDQSAISVP
SLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNGS
SQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQSSISSPPTCSVKSPQGCVVERP
PSSSQQLAQCSMAANFTPPMQLAEIPETGNANLGLYERMGQSDFGAGHYPQPSATFSLAK
LQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMT
PPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKSASLSPAAATH
QSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPSPAYNVNSVNMNMNTLNAMNGYSMSQ
PMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHSNMMYTAPGHHGYMNT
GMSKQSLNGSYMRR
NT seq 6165 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgccgtcagcacttcccat
gggttggataagaagacagtctctgaacagctggaactcagcgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctacaaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcaaccaaggggtctagaggatcatgcaat
gatctgcgcaacgtggattggaataaacttctaaggagagcaattgaaggactggaggag
ccaaatggctcctccctgaagaacattgagaagtatctcagaagtcaaagtgatctcaca
agcaccaccaccaacccagcctttcagcagcggctgcgactgggggccaaacgcgcagtg
aacaatgggaggttactgaaagacggaccgcagtacagggtcaattacggaggcttagat
ggcaaaggggctcccaagtaccccagtgctttcccatcttcgctcccacctgtcagcctt
ctaccccacgagaaagatcagccccgtgccgatcccattccaatatgtagcttctgtctg
gggacaaaggaatcaaatcgtgaaaagaaaccagaagaacttctctcttgtgcagattgt
ggcagtagtgggcacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacgtgcagtgcatgcagaatccaaggcaaa
aatgcagataatatgcttttctgtgactcctgtgatagaggattccatatggagtgctgt
gatcccccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatccggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagccatgcacttctcatgtgttggct
ccaggtaccacacaaaagctaaagcctccactttcttcactcccacccccgacccccatc
tctggtcagagccccagctcacaaaagtccagcacttctgttccttctacctctcctcag
agttcctccagccagtccagcgtgccctcctttagcagtcttactaataacagccagctg
aaggcactctttgacggactctctcatatctataccactcagggacagtctcgccaaaag
ggacacccaagttatgcaccgcctaaacgtatgcgtcgtaaaaccgaattccctctcaca
gcaaagtctaaagcccatttctttggaaaaagagatgttagaagtaggtttatttctcac
tcctcctcctctagctgggggatggctagagggcgtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcaggttaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatacggaaatcaaaataagcatcaaacaggaaagtacagatataaat
gtgattggaaacaaggataccgttactgaagaggatttggatgttttcaagcaggcccag
gaactgtcttgggagaagatagagtgtgaaagtggagtagaagactgtggccggtaccct
tctgtaatagaatttgggaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttattaagacactcaaagaaatgtggatggtttcatcctccagcaaatgaa
atttaccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacattgtattatgat
gtcgagccattccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaaactttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctcgaagagaaggccaagcagggtctcctgaaaagccactctccgatctaggccgtctc
tcctacctggcctactggaagagtgtcatcttagaatatctctaccaccaccacgagcgg
cacatcagcatcaaagccatcagcagagctacgggcatgtgcccccatgacatcgccacc
actctgcagcacctccacatgattgacaagagagatggccgatttgtcatcattagacgg
gaaaagttgatattaggccacatggaaaagttgaaaacctgttcccggaccaatgaactt
gatccagagagtctgaggtggaccccaatcttaatttctaatgctgcagtttctgaagaa
gaacgagaagccgaaaaagaggccgagcggctaatggaacaagctagctgctgggaaaaa
gaggagcaagaaatcctgtcatctagagctaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtggcaggggagcgagggcag
ctgatggagctgtctaaagagagcagtgaagaagaggaggaggaagaagaggaagaggaa
gaggaggaggaggaagaagaggaggaggaggaagaggaagaagaggaagaggaagaaaat
atccaaagctctcctccaagattgactaaaccacagtcagttgccataaagagaaagagg
ccttttgtactaaagaagaaaaggggtcgtaaacgcaggaggatcaacagcagtgtaaca
actgagaccatttctgagacgacagaagtactgaatgagccctttgacaactcagatgaa
gagaggccaatgccacagctggagcctacctgtgagattgaagtggaggaggatggcagg
aagccagtgctgagaaaagcattccaacatcagcctgggaagaaaagacagacagaggaa
gaggaaggaaaagacaatcattgctttaagaatactgacccttgtagaaacaatatggat
gatggtgcaaataacttgaaagaagccagtagagacaatcccgaacctctgaagtgcaaa
cagtggccaaaaggaacaaagcgtggtctgtctaagtggaggccaagcaaagagaggaag
actggatttaaactgaacttgtacaccccgccagaaacacccatggagcctgatgaccag
gtaacagtagaagaacagaaggagactccagcagacaaacccagcccctcttccaccagg
actgaggaggggctcaaggaagccgtggaacccctgctgcctcgggacgaaaacggaagg
gaggagacgtgtgcacctgtaagtccaaataaatcaccggctggaaaacctgaagacgat
gtactcaaacctgaggaggaagaggaggaggaagaagaagaggaagaggaaggaaatgta
gaaaaagaccccagtggtgccaagagtcaggaaaaagaggagccagaagtctgcatggac
aaagaagaccctgtgcgtttggatgatcatgaagaggaggaggaagaggaggaagagcca
tctcacaacgaggggcatgatgccgatgatgaggatgacagtcacatggagtctgctgaa
gtggagaaggaagaacacccaagagaagccttcaaagaagtactggaaaaccaggaggct
tttttagaccttagtgtccagcctagtcattcaaacccagaggtcctaatggactgtggt
gttgacctcccagcttcgtgtaatagtgaacctaaggagcttgctggagccactgaaact
gcccctgagtctgatgaggaacccccaggagagcaggcacagaagcaggaccaaaagaac
agtgaagaagtagattctgagttcaaagagggaaacacagccaccttggaaatagactct
gagaccgtccaggcggttcagtccttgacccaggagaacagtgaacaggatgacaccttt
caggattgcgccgagactcaagaggcctgtagaagcctacagaactacacccacgcagac
caaagcccgcagatctccgccactctagatgactgccagcagtcagaccacagcagccca
gtttcatccgtccattcccaccctggccagtcagtacgttctgtcagtagcccaagcgtc
cctgccctggaaaacagctatgcccaaatcagcccagatcaaagtgccatctcagtgccg
tctctgcagaacatggaaaccagtccaatgatggacgtcccgtccgtttcggatcattcg
cagcaagttgtggacagcgggtttagtgacctgggcagtattgagagcacaaccgagaac
tacgaaaacccgagcagctatgattctaccatgggtggcagcatttgtggaaatggctct
tcacagaacagctgctcctacagcaacctcacctccagcagtctgacacagagcagctgt
gctgtcacccagcagatgtccaacatcagcgggagctgcagcatgctgcagcagagcagc
atcagctcccccccgacctgcagcgtcaagtctcctcaaggctgtgtggtggagaggccc
ccaagcagcagccagcagctggcacagtgcagcatggccgctaacttcacgccgcccatg
cagctggctgagatccccgagactggcaatgccaaccttggcttatatgaacggatgggt
cagagtgattttggggctgggcattacccacagccgtcagccaccttcagccttgccaaa
ctacagcagttaactaatacacttattgatcattcattgccttacagccattccgctgct
gtaacttcctatgcaaacagtgcctctttgtccacaccattaagtaacacagggcttgtt
cagctttctcagtctccacactccgtccctgggggaccccaagcacaagctaccatgacc
ccaccccccaacctgactcctcctccaatgaatctgccaccacctctgttgcaacggaac
atggctgcatcaaatattggcatctcccacagccaaagactgcaaacccagattgccagc
aagggccacgtctccatgagaaccaaatcggcatctctgtcaccagccgctgccacccat
cagtcgcaaatctatgggcgctcccagactgtagccatgcaaggtcctgcacggacttta
acgatgcagaggggcatgaacatgagtgtgaacctgatgccatccccagcctacaatgtc
aactctgtgaacatgaacatgaacaccctcaatgccatgaacgggtacagcatgtcccag
ccgatgatgaatagtggctaccacagcaatcatggctacatgaatcagacgccccagtac
cctatgcagatgcagatgggcatgatggggacccagccatatgcccagcagccaatgcag
accccgccccacagtaacatgatgtacacggcccccggacaccatggctacatgaacaca
ggcatgtccaaacagtctctcaatgggtcctacatgagacggtag

DBGET integrated database retrieval system