KEGG   Bos mutus (wild yak): 102286022Help
Entry
102286022         CDS       T02919                                 

Definition
(RefSeq) seminal ribonuclease-like
Organism
bom  Bos mutus (wild yak)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 150 aa AA seqDB search
MALKSLVLLPLLVLVLLLVRVQPSLGKESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRK
MTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPN
CAYKTTQVEKHIIVACGGKPSVPVHFDASE
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagtctctagtcttgttgccactgctggtcctggtgctgctgctggtgcgg
gtccagccttccctgggcaaggaatctgcagctgccaagtttgagcggcagcacatggac
tctggcaactcccccagcagcagctccaactactgcaacctgatgatgtgctgccggaag
atgacccaggggaaatgcaagccagtgaacacctttgtgcatgagtccctggccgatgtt
aaggccgtgtgctcccagaagaaagtcacttgcaagaatgggcagaccaactgctaccag
agcaaatccactatgcgcatcacagactgccgcgagactggcagctccaagtaccccaac
tgtgcctacaagaccacccaggtggagaaacacatcatagtggcttgtggtggtaaaccg
tccgtgccagtccacttcgatgcttcagagtag

DBGET integrated database retrieval system