KEGG   Bos mutus (wild yak): 102286342Help
Entry
102286342         CDS       T02919                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
bom  Bos mutus (wild yak)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102286342 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102286342 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102286342 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    102286342 (MGLL)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102286342 (MGLL)
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S33
   102286342 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 303 aa AA seqDB search
MPEERPPRLTPQNVPYQDLPHLVNADGQHLFCRYWRPLSAPRALVFVSHGAGEHCGRYDE
LAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDAVQKDHPGLPIFLLG
HSMGGAICILTAAERPGHFSGMVLISPLVVANPDSATLLKVFAAKVLNLVLPNMSLGRID
SSVLSRNKTEVDIYNTDPLVCRAGLKVCFGNQLLNAVSRVERALPKLTLPFLLLQGSADR
LCNSRGAYLLMESARSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWVSQRTAVEGTG
CPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaacgtccccccaggctgaccccgcagaacgttccctaccaggacctccct
cacctggtcaacgctgacgggcagcacctcttctgccggtactggagacccttgagcgcg
cccagggccctggtgttcgtgtcccatggagccggcgagcactgcggccgctacgatgag
ctggcgcagatgctggtggggctgggcctgctggtcttcgcccacgaccacgtcggccac
gggcagagcgagggcgagaggatggtggtgtccgacttccacgtcttcatccgggatgtg
ctccagcacgtggacgccgtgcagaaggaccacccggggctgcccatcttcctccttggc
cactccatgggcggcgcgatctgcatcctcacggccgcggagaggccgggccacttctcg
ggcatggttctcatttccccgctggtcgtcgccaatccagactcggcgacacttctcaag
gtcttcgctgcgaaagttctgaacctcgtcctgccaaacatgtccctgggccggatcgac
tccagtgtgctctcgaggaataagacggaggtggacatctacaacacggaccccctggtc
tgccgcgcggggctcaaagtctgcttcggcaaccagctgctcaacgcggtgtcgcgggtg
gagcgggcgctgcccaagctgacgctgcccttcctgctgctgcagggctctgccgaccgc
ctctgcaacagcaggggcgcctacctgctcatggagtcggccaggagccaggacaagacg
ctcaagatttacgaaggtgcctatcacatcctccacaaagagcttcctgaggtgaccagc
tctgtcttccgggagataaacacgtgggtctcgcaaaggacagcggtggagggaacgggg
tgcccaccctga

DBGET integrated database retrieval system