KEGG   Bos mutus (wild yak): 102286979Help
Entry
102286979         CDS       T02919                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
bom  Bos mutus (wild yak)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102286979 (POMT1)
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     102286979 (POMT1)
Glycosyltransferases [BR:bom01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102286979 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 736 aa AA seqDB search
MLGFLQQPVMVTTEVNLNMVALTAVGLLSRLWQLAYPRAVVFDEVYYGQHISFYMKRTFF
LDGSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALSGALSVPMAY
EIVWELGFSHCAATGAALLLLIENALITQSRLMLLESVLIFFNLLAVLSYLKFCNSQKHR
PFSPRWWFWLVLTGVACSCAVGIKYVGVFTYLLVLGVAAVHAWHVIGDQTLSNVGADVPS
ILWQVRVLCHLLARAAALVVLPVLVYLLFFYIHLLLLCRSGPHDQIMSSAFQASLEGGLA
RVTQGQPLEVAFGSQVTLKNVFGQPVPCWLHSHQSTYPMIYENGRGSSHQQQVTCYPFKD
VNNWWIVKDPGRHQLVVNNPPRPVRHGDVVQLVHGMTTRLLNTHDVAAPLSPHAQEVSCY
IDYNISMPPQNLWRLDIVNRESDTDVWKTILSEVRFVHVNTSAILKLSGVPLPDWGFRQL
EVVGEKLFRGYHGSTVWNVEEHRYGRSQEQKERELELHSPTQVDISRNLSFMARFSELQW
RMLTVRSDDSEHKYSSTPLDWVMLDTNIAYWLHPRTSAQIHLLGNVVIWASASLATLVYA
LLFIWYLLRRRRRVCDLPEDRWLRWVLAGALCAGGWAVNYLPFFLMETPLFLSHYLPSLP
FQILLLPVVLEHISDHLCRSQLQRSLFTALVVAWFTSACHVSNMLRPLTYGDRSLSPSEL
KALRWKDSWDILIRKY
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgttgggattcttgcagcagcctgtgatggtgaccactgaggtgaacttgaatatggta
gctctgaccgcggtgggattgctgagccgactatggcagcttgcctatccaagggccgtg
gtttttgatgaagtgtattacgggcagcacatctctttttatatgaagcggaccttcttt
ttggatggcagtggaccaccgtttggccacatgcttttggccttgggaggttatttagga
ggattcgatggtaactttctgtggaacagaattggagcagaatacagcagcaatgtgccc
gtgtggtccctgcgcctgctgccggccctttcgggggccctgtcggtgcccatggcctat
gagatcgtgtgggagctcggcttctctcactgtgccgccacgggggctgctctgctgctg
ttgattgagaacgctctcatcactcagtcaaggttaatgcttttggaatcagtgctgata
tttttcaatctgttggccgtgctgtcttacctgaagttctgcaactcccagaaacacagg
cccttctccccgagatggtggttttggttggtgctgacaggcgtggcctgctcctgtgca
gttggcatcaagtacgtgggtgtgttcacatacttgctggtgctcggggttgctgctgtc
cacgcctggcacgtgataggagaccagacgctgtcaaacgtaggtgccgatgtcccctcc
atcctctggcaggtccgtgtgctctgccacctgctcgcccgagcagcggccctggtggtg
ctcccggtcctggtgtacctgctgttcttctacatccacctgctgctgctctgccgctcc
gggccccacgaccagatcatgtccagtgccttccaggccagcctggagggggggctggca
agggtcacacaaggtcagcctctggaggtggccttcggttcccaggtcaccctgaagaat
gtctttggccaacccgtgccctgctggcttcactctcaccagagcacctaccctatgata
tatgagaacggccgtggcagctcccaccagcagcaggtgacctgctaccccttcaaggat
gtcaacaactggtggattgtcaaggaccccgggaggcaccagctggtggtgaacaacccc
ccgaggcccgtgcggcacggcgacgttgtgcaactggtgcacggcatgaccacccgcctc
ctcaacacgcatgatgtcgcagcccccctgagcccccacgcacaggaggtttcctgctac
attgactacaacatctccatgcccccccagaacctctggcggctggacatcgtgaacagg
gagtcggacacggatgtctggaagaccatcttgtcggaggtccgctttgtacacgtgaac
acctcggccatcctcaagctgagtggagtgcccctcccagactggggctttcggcagctg
gaagtggtcggggagaagctgtttcggggctaccacgggagcactgtgtggaacgtggag
gagcaccgctacggcaggagccaggagcagaaggagagggagctggagctgcactccccc
acccaggtggacatcagcaggaacctcagcttcatggccagattctccgagcttcagtgg
cggatgctgacggtgagaagtgacgattcggaacacaagtacagctccacgccgctggac
tgggtcatgctggacaccaacatcgcttactggctgcaccccaggaccagtgcgcagatc
cacctgcttgggaacgtcgtgatctgggcctccgccagccttgccaccctggtgtacgcc
ctgctgttcatctggtacctgctcagacgcagaaggagagtctgcgacctccctgaagac
cgctggctgcgctgggtgctggccggggctctgtgcgccgggggctgggctgtgaactac
ctgcctttcttcctgatggagacgccgctctttctctcccactacctgccgtcgctcccc
ttccagatcctgctgctgcccgtggtcctggagcacatcagcgaccacctgtgcaggtcc
cagctccaaaggagcctcttcacggccctggtcgtcgcatggttcacctctgcctgtcac
gtgtcgaacatgctgcgcccgctgacctatggggacaggtctctgtcacccagtgagctc
aaggcccttcgctggaaagacagctgggatatcctgatccggaaatactag

DBGET integrated database retrieval system