KEGG   Bos mutus (wild yak): 102287025Help
Entry
102287025         CDS       T02919                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
bom  Bos mutus (wild yak)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102287025
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     102287025
Glycosyltransferases [BR:bom01003]
 Glycan extension
  Type 3 chain
   102287025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 368 aa AA seqDB search
MASKSWLNILTFLCGSAVGFVLCSQLLSILFEEQKDIQPSILHNDPHARHSDDNEQNHLE
GQMNFDADASQHKDENTDIADKLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVEAFKTDKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPEKMLKEVSQIYKNEDTNVNQ
EPLKEKHK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaatattttaaccttcctttgtggatcagcagtcggattt
gttttatgctctcagctacttagtattttgttcgaagaacagaaggacatccagcctagt
attcttcataatgatcctcacgctaggcattcagatgacaatgaacagaatcatctagaa
ggacagatgaacttcgatgcagatgccagccaacataaagatgagaacactgacatcgct
gataagctctatcagaaggttaaaattctttgctgggtaatgacagggcctcaaaatcta
gagaaaaaggctaaacatgtcaaagccacatgggcccagcgttgtaataaagtgttgttt
atgagttcagaagaaaacaaggacttccctgctgtgggattaaaaaccagagaaggcaga
gaccaactgtactggaaaacaattaaagcctttcagtatgttcatgatcattatttagaa
gatgctgattggtttatgaaagcagatgatgatacttacgttatactagataacttgaga
tggcttctctcaaaatacaaccctgaagaacccatttactttgggagaagatttaagccc
tatgtaaagcagggctacatgagtggaggagcaggatatgtactgagcaaagaagctttg
aagagatttgttgaagcatttaaaacagacaaatgtacgcacagttcctcaatcgaagat
ttagcactggggagatgcatggaaattataaatgtagaagcgggagattccagagacacc
actggaaaagaaacttttcatccttttgtaccagaacaccacttaatcaagggttatctg
ccgagaaccttttggtactggaattataactattatcctcctgtagagggtcctggttgc
tgttccgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccgtatggttatttatacagataccaacctgccttacct
gagaagatgctaaaggaagtaagtcagatatacaaaaatgaagacacaaacgtaaatcag
gagcccttgaaagaaaaacataaatga

DBGET integrated database retrieval system