KEGG   Bos mutus (wild yak): 102287934Help
Entry
102287934         CDS       T02919                                 

Gene name
ABAT
Definition
4-aminobutyrate aminotransferase
Orthology
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bom  Bos mutus (wild yak)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bom00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bom00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bom00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bom00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bom00410]
Organismal Systems; Nervous system; GABAergic synapse [PATH:bom04727]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 499 aa AA seqDB search
MASMLLTQRLVCSFQHNYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALMKLVQQPQ
NMSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQSSFSKEELETCMVNQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEELRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLLXAAHAGKVLLTGLLD
LQARFPQLISRVRGRGTFCSFDTPDESVRNKLISVARSKGLMLGGCGDKSIRFRPTLVFR
DHHAHLFLNIFSDILADFK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcacccagcggctggtctgcagcttccagcacaactaccgcctg
ttggtgccgggatccagacacatcagtcaggctgcagccaaagtcgatgttgaatttgac
tatgatggacctttgatgaagacggaagtcccagggcctagatctcgggagctaatgaaa
cagttgaatataattcagaatgcagaggctgtgcactttttctgcaattatgaagagagt
cgaggcaattacctggtggatgtggacggcaaccggatgttggatctttattcccagatc
tcctcggtccctataggttacaaccatcctgctctcatgaaactcgttcaacagcctcaa
aatatgagcacattcatcaacagacctgccctcggaatccttcctccggagaactttgtg
gagaagctccgggagtccctgctctcggtggctcccaaagggatgtcccagctcatcacg
atggcctgcggctcctgctccaacgagaacgccttcaagaccatcttcatgtggtaccgg
agcaaggaaaggggccagtcgagtttctccaaagaggagctggagacgtgcatggtcaac
caggcccctgggtgccctgactacagcatcctgtccttcatgggtgctttccacgggagg
accatgggttgcttagcaaccacgcactccaaagccattcacaagatcgacatcccctcc
ttcgactggcccatcgcaccgttcccacggctgaaatatcctctggaagagtttgtgaaa
gagaaccaacaagaagaggcccgctgtctagaagaggtggaggacctgatcgtgaaatac
aggaagaagaagaggacggtggccggcatcattgtggagcccatccagtctgagggcgga
gacaaccacgcgtcggacgacttcttccggaagttgagagacatctccaggaagcacggc
tgtgccttcttggtggacgaggttcagactggaggaggctgcaccggcaagttctgggcc
cacgagcactggggcttggatgacccggcggacgtgatgaccttcagcaagaagatgatg
accgggggcttcttccacaaggaggagttgcggcccaacgctccttaccggatcttcaac
acgtggctgggagacccatccaagaacctgctgctggccgaggtcatcaatgtcatcaag
cgagaggacctgctgnncgcagcccatgctgggaaggtcctgctcacaggactgcttgac
ctccaggcccggttcccccagctcatcagcagagtcagagggcgaggcaccttctgctcc
ttcgacactccagacgaatccgtgcggaataaactcatttcagtagccagaagcaaaggc
ctgatgctggggggctgcggcgacaagtccatccgcttccgtcccactctggtcttccga
gatcaccacgcccacctgttcctcaacatctttagtgacatcctagctgacttcaagtaa

DBGET integrated database retrieval system