KEGG   Bos mutus (wild yak): 102288102Help
Entry
102288102         CDS       T02919                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102288102 (JOSD2)
Peptidases [BR:bom01002]
 Cysteine Peptidases
  Family C86
   102288102 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 188 aa AA seqDB search
MSQAPGAQPSRPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGQGLAAVWWDRRRPLSXLALPRVLGLILNLPSPVSLGLLSLP
LRRRPWVALRQVDGVYYNLDSKLRAPEVLGDEDGVRAFLAAALAQGLCEVLLVVTKEVEE
QGSWLQAD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccaggagctcagccaagccggccctccgtgtaccacgaacggcaacgc
ctggagctctgtgccgtgcacgccctcaacaacgtcctgcagcagcagctcttcagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaacccccatcgc
agcctcctgggcaccggcaactacgacgtcaacgtgatcatggctgccctgcaggggcag
ggcctggctgccgtgtggtgggaccgaaggaggcccctgtcctagctggcgctgccccgg
gtactggggctgatcctgaacctgccctcgcccgtctcgctggggctgctgtccctgccc
ctgcgccggcggccctgggtggccctgcgccaggtggacggcgtctactacaacctggac
tccaagctgcgggcgccagaggtgctgggcgacgaggacggcgtcagggccttcctggcg
gccgcgctggctcaaggtttgtgcgaggtgctgctggtggtaaccaaggaggtggaggag
cagggctcctggctgcaggcagactga

DBGET integrated database retrieval system