KEGG   Bipolaris oryzae: COCMIDRAFT_103643Help
Entry
COCMIDRAFT_103643 CDS       T03125                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bor  Bipolaris oryzae
Pathway
bor00052  Galactose metabolism
bor00500  Starch and sucrose metabolism
bor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bor00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    COCMIDRAFT_103643
   00500 Starch and sucrose metabolism
    COCMIDRAFT_103643
Enzymes [BR:bor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     COCMIDRAFT_103643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N DUF4981
Motif
Other DBs
NCBI-GeneID: 19118348
NCBI-ProteinID: XP_007691109
JGI: Cocmi1_103643
UniProt: W6ZFV1
Position
Unknown
AA seq 637 aa AA seqDB search
MKFSSSRDLVVVLSFATEATSRILVRQPTAIDYNAAPPNLSTLANNSLFETWRPRAHVLP
AFGQIGDPCMHYTDPVTGLFHVGYLHLGASGATTSDLVTYKDLNPNSAPFIRAGGINDPV
AVFDGSVIEKGVNGTPTLLYTSVRYLPIQWTIRYTKGSETQSLAYATDGGKNFTKAKFGP
VIPSPPFAVNVTGFRDPFVFQSPQFDSLLSKKKDTWYTLISGGVHGVGPSLFLYAQYDDS
DAASFQTWEYLGEYWHEAANTTWTESNWAGRWGFNFEVANIFSLDEHGANHSTGETFLTV
GAEWSYAPIVPQVSDERDMLWIAGTQSLVDGKLTFEPTMAGRLDAGRSAYAAAGKLLSAD
SQPSWASGAPDRAITYLWLTGDLYGTSAFPTAQQNWTGSLLLPRELSRCYIDVLDTPLAR
ETGAWRVERENGDGTLRLATLCQKIAREVKTAFKANATNVITLPADELSPGEQYKLPQSP
KENHYMLTASLTFSSRTPGLKAGFTILEGTHETTRVVYDIGAEQLSVERGRSSAAANTTQ
GIPTYDEEGLFRLFDLPTHANASRIETLNLTIVVDGGVVEVHANDRFALSTWARPWYADS
KGVGVFVEGEGEEAVSVSEVKVYEGLVDAWPKRSKTI
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctcgtcatcacgcgatttggtggtggtgttatcgtttgcaacggaagcaaca
agtcgaattctggtccgtcaacctacggctatcgactacaatgccgctccaccgaatctc
tctacgctagcgaataactcgctcttcgaaacttggaggcccagggcacatgttctaccg
gcgtttggccaaattggagatccgtgtatgcattatacagatcctgtgactgggcttttc
catgtcggatatctgcatctaggggcatcaggtgcgacgacgagcgatctggttacgtac
aaggacttgaatcccaattccgcgccgttcatccgtgcaggtgggataaacgatcccgtt
gcagtcttcgatggcagtgtgattgaaaaaggtgtaaacggcacacctacgctcctctac
acaagcgtccgctacctccccatccaatggacaatccgatacacaaagggcagcgaaaca
caatcactcgcctacgccacggacggcggcaagaactttacaaaagccaagtttggcccc
gttatccccagtcctcccttcgccgtcaacgtaacgggattcagagacccattcgtcttc
caaagcccacaattcgattctctcctcagcaagaaaaaagacacatggtacaccctcatc
tccggcggtgtccacggtgtaggccccagcctcttcctctacgcccaatacgacgactca
gacgccgcctcattccaaacctgggagtacctaggcgaatactggcacgaagccgcaaac
accacctggaccgaatccaactgggctggccgctggggcttcaacttcgaagtcgcaaac
atcttctccctcgatgagcacggcgcgaaccattccaccggcgaaaccttcttaaccgta
ggcgcagaatggagctacgcacccatcgtacctcaagtctctgacgaaagagatatgctc
tggatcgctggcacccagtccctcgtcgacggcaaactaacttttgaaccgacaatggca
ggcagattagatgcaggccgctccgcctacgcagcagccggcaagcttctttccgcagac
tcgcagcccagctgggcgagcggcgcccccgatcgcgcaatcacgtatctctggctcacg
ggcgatctctacggcacatctgccttccctaccgcccagcaaaactggacaggttcctta
cttctcccgcgcgagctatcgcgctgctacatcgatgtgctcgatacgccgctggcccgc
gaaaccggggcgtggagggtcgagcgggagaacggagacggtacgctgcgacttgcaacg
ttgtgccagaaaatcgcacgagaagttaagactgcgttcaaggcgaatgcaacaaacgtc
ataaccttgcctgctgacgagctttcacccggcgagcagtacaaattaccacagtccccc
aaggagaatcactacatgcttactgcctctctgactttctcctctcgcacaccaggcctc
aaggcaggctttactatcctcgagggcacgcatgagacgacgcgtgtggtgtacgatatc
ggcgccgagcagctgagtgtggagcgtgggaggtcgtcagcggcggcgaatacgacgcag
ggcatcccgacgtacgacgaggagggtttgttccgactgtttgatttaccaactcacgcc
aatgcttcgcggattgagacgctgaatctgactattgtagtagatggtggggtagtcgag
gtgcatgcgaatgatcggtttgcgctgagtacgtgggcgaggccgtggtatgcggatagt
aagggtgttggcgttttcgtcgagggcgaaggagaggaggcagtaagcgtgagcgaggtg
aaggtttatgagggtttggtggatgcgtggccgaagagaagcaagacgatttag

DBGET integrated database retrieval system