KEGG   Brucella ovis: BOV_0032Help
Entry
BOV_0032          CDS       T00534                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bov  Brucella ovis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bov03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(38470..39168)
Genome map
AA seq 232 aa AA seqDB search
MFGWQIAAMPHPPKFPFPTPLLPYSLTPLQKMSKRIAGPEIERLIQLLARVPGLGPRSAR
RAALHLIKKKEALLVPLGGAMQEAAEKVRICSCCGNVDTSDPCTICTDERRAPATLIVVE
DVSDLWALERAGTMNVRYHVLGGRLSPLDGIGPDDLNIKGLVERVASGAIKEVILAVNAT
VEGQTTAHYITDQLSNFDVRVTRLAHGVPVGGELDYLDEGTLAAALRARTTL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtttggttggcagattgccgccatgccgcatcctcccaaattcccgttccctaccccc
ttactcccctattcccttactcccttacaaaaaatgtccaaacgaatagccggtcctgaa
atcgaacgtctgatccagcttctggcccgcgtgccggggctcggaccgcgctcggcccgc
cgtgcggcgctgcatctcatcaaaaagaaggaagcgcttctggtgccgcttggcggcgcc
atgcaggaggccgctgaaaaggtgcgcatctgttcgtgttgcggcaatgtcgatacgtcc
gacccgtgcacgatctgcaccgatgagcgccgcgctccggcaactttgattgtcgtggag
gatgtatccgatctctgggcgctggagcgggcaggcacaatgaatgtgcgctatcatgta
ttgggtggccgcctgtcaccgctcgatggcatcggcccggacgatctcaacatcaagggg
ctggtggagcgggttgcaagcggcgccatcaaggaagtgatcctcgcggtcaacgccact
gtcgaaggccagacgaccgcccattacatcacagaccagctatcgaatttcgatgtgcgc
gtgacacggcttgcccatggcgttcccgttggcggcgaacttgactatctggatgaaggc
acgcttgctgctgcgttacgggcgcgaaccacgctttaa

DBGET integrated database retrieval system