KEGG   Brucella ovis: BOV_0039Help
Entry
BOV_0039          CDS       T00534                                 

Definition
cytochrome c, membrane-bound
Orthology
K08738  
cytochrome c
Organism
bov  Brucella ovis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BOV_0039
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BOV_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:45139..45717
Genome map
AA seq 192 aa AA seqDB search
MAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAAPAKEEVSIATLLQ
SADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSAAMKEFGAAGN
KWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVPLPAADAAPAD
SDKKPAEAAPAN
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcatttctggcaacggttttcgttgtcatgacgacgggcattctgtctgattcgctg
tttcattcgccggctcctgaaaagccgggctttgccatagaggtagcccaaggttcgggg
ggcggagaaagtgctgcggctcccgccaaggaagaagtttcaattgcaaccctgttgcaa
agtgccgatccggcgcgtggcgaagtggttttcaagcgttgccaggcttgccacaccggg
gacaagggcggggccaacaaggttggtccgcatctgtggggtgtcgtgggtcgcccggct
gcctccgttgaaggtttcagctattccgctgccatgaaggaattcggcgcggctggcaac
aagtgggattttgagcatctcaacaagttcctcacctcgccgaaaggcttcatcaagggt
acagccatgggctttgccggtgacaagaaggataatgagcgcgctgacctgattgcttat
ctgcgcacgctgtccgacaatccggtgccgctgccggccgcagacgcagcgcccgcagat
agcgataaaaagcccgccgaagctgcaccggccaattga

DBGET integrated database retrieval system