KEGG   Brucella ovis: BOV_0139Help
Entry
BOV_0139          CDS       T00534                                 

Gene name
glnD
Definition
(GenBank) protein-P-II uridylyltransferase
  KO
K00990  
[protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
bov  Brucella ovis
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:bov00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BOV_0139 (glnD)
Enzymes [BR:bov01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     BOV_0139 (glnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(157900..160704)
Genome map
AA seq 934 aa AA seqDB search
MSAHDLKLEEIVNAETLRRKLNELADTADESYTSLPMRKVVLQTLKDALASGRANAEDML
MKDGGGTLCAKRLCYLMDTLIDILFEFATTRAYPTRNPSKAENMALVAVGGYGRGGLAQG
SDIDLLFLLPYKQTPWGEQVVEYTLYMLWDMGLKVGHSTRNIDECIRLAREDMTIRTALL
DARFLTGDKDLFRTLEIRFEEEIVKGTEPEFIQAKLAERDARHRKAGETRYLVEPNVKEG
KGGQRDLHTLFWITKYFYRVKTKEELVKLGVLSRAELKLFNKAEDFLWAVRCHMHFATLK
AEERLSFDIQPEIAQRLGYTAHPGQNYVERFIKHYFLVAKDVGDLTRIICAALEEQQAKH
VPGFNRIFLTFSRRKRKLSDDGAFISENHRINIARPDIFRQDPVNMIRLFHLADRHGLEF
HPEAMQSLTRSLKLINADLRENPEANRLFLEILTSPRNPELILRRMNESGVLGKFIPDFG
KIVAMMQFNMYHHYTVDEHLLRCIAVLSEIEHGELKTEHPLSNHLITTIKRDRNLLYVTL
LLHDIAKGRPEDHSIAGARIARRLCPRFGLTPSETETVEWLVREHLTMSMVAQSRDLNDR
KTIIDFADTVQTMERLKLLLILTVCDIKAVGPGIWNGWKGQLLRTLFYETELVLTGGFSE
LSRAARDKQAREALAERLSDWPKEERDAYLALPYTNYFLTVSLDDQVRHAHFIRDADQQG
RALVTMAKPHAFEAVTEITVLAPDHPRLLSVITGACAAAGGNIVDAQIFTTSDGRALDTI
LISREFDTDDDERRQAERVGKVIEDVLSGKAHLPDMLAKRTKPKKAARAFKVEPRVEINN
TLSNKFTVIEVEGLDRPGLLSELTGLISDLSLDIASAHITTFGEKVIDSFYVTDLVGHKI
SNATRQGNIKRKLLALLGAENGARTNGRSPQAAA
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacacgacctgaagctggaagagatcgtcaatgccgaaacgctccgtcgcaag
ctcaatgaactggcggacacggccgatgaaagctacaccagccttcccatgcgcaaggtt
gtgctccagacgctgaaggatgcgctggcgagcgggcgcgccaatgccgaagacatgctg
atgaaggatggcggcggcacgctttgcgccaagcggctctgctacctgatggatacactg
atcgacatcctgtttgaattcgcaaccaccagggcctatccgacgcgcaatccctccaag
gcggagaatatggcgctcgtggcagtcggcggctatgggcgcggcgggcttgcacagggt
tccgacatcgaccttcttttcctgcttccctataaacagacgccctggggcgaacaggtt
gtggaatatacgctctacatgctctgggacatggggctgaaagtcggccattccacccgc
aacatcgatgagtgcattcgtctggcgcgcgaggacatgaccattcgcacagcccttctc
gatgcgcgctttcttaccggcgacaaggatctgttccgcacacttgaaatccgtttcgag
gaggaaatcgtcaagggaacggagccggaattcattcaggcaaagcttgccgagcgcgat
gcacgccaccgcaaggcaggtgaaacacgctatctggtcgaaccgaacgtcaaggaaggc
aagggcggacagcgcgacctgcacaccctgttctggatcaccaaatatttctaccgcgtg
aagaccaaggaagagctggtcaagcttggggttctgtcgcgagcggaactgaaattgttc
aacaaggctgaggattttctctgggcggtgcggtgccatatgcattttgcgacgctgaaa
gccgaagaacgcctttccttcgacattcagccggaaatcgcacagcgcctcggctatacg
gcgcatcccggccagaactatgtcgaacgcttcataaagcattatttcctcgtcgcgaag
gatgtgggtgacctcacccgcatcatctgcgcggcgctggaagaacagcaggcaaagcat
gttccaggcttcaaccgcatcttcctgaccttctcgcgccgcaagcgcaagctttcggat
gatggcgctttcatttcggaaaaccatcgcatcaatatcgcacggcccgatattttccgg
caggacccggtcaatatgatccggctctttcaccttgccgaccgccatgggctggagttt
catcccgaagcaatgcagagcctcacccgctcgctgaagctcatcaatgccgacctgcgc
gagaacccggaggccaaccggcttttcctcgaaatcctcacctcgccgcgcaatccggaa
cttatcctgcgccgcatgaacgaatccggcgtgcttggaaaattcattcccgatttcggc
aagatcgtcgcgatgatgcagttcaatatgtatcaccactatacggtggacgagcatctg
ttgcgctgcattgccgtgctttcggaaatcgagcacggcgagcttaaaaccgagcacccg
ctttcaaaccatctcatcaccacgatcaagcgcgaccgcaacctgctttacgtgacgctt
cttctgcacgatatcgccaagggccgcccggaagaccactccatcgcgggcgcacgcatt
gcccgcaggctttgcccgcgcttcggcttgacaccatccgaaaccgagaccgtggaatgg
ctggtgcgcgaacacctcaccatgagcatggtggcgcaatcgcgcgatctcaacgaccgc
aagaccattatcgattttgccgatacggtgcagacgatggagcggctgaagcttctcctg
atcctcaccgtttgtgatatcaaggcggtcggccccggcatatggaacggctggaaaggc
cagcttctgcgcacgcttttctatgagaccgaactggtgctgacgggcggattttccgaa
ttgtcgcgggccgcccgcgacaagcaggcgcgtgaggcgctggccgagcggctttccgac
tggccgaaggaagagcgcgacgcctatcttgccctgccctataccaattatttcctcacc
gtcagcctggacgatcaggtgcgccatgcgcatttcatacgcgatgccgaccagcagggc
cgtgcgctcgtcaccatggccaagccgcacgcattcgaggccgtgaccgaaattaccgtt
ctcgcgcccgaccatccgcgtctcctttcggtcattaccggagcctgcgcggcagcgggc
ggcaatatcgtggatgcgcagatttttaccaccagcgacgggcgtgcgctggacacgatc
ctcatcagccgcgaattcgacaccgacgacgacgaacgccgccaggccgagcgcgtgggc
aaggtgatcgaggacgtgctttccggcaaggcgcatctgcccgatatgctggcgaagcgc
accaagccgaagaaagctgccagggctttcaaggtggagccgcgtgtcgagatcaacaac
acgctttccaacaaattcacggtcatcgaagtggaaggtctggaccggccgggcctgctt
tcagagctgaccggccttatttccgacctttcactggatatcgcttcggcccatatcacc
actttcggcgagaaggtgatcgacagtttttatgtgacggatctcgtgggccacaagatt
tcaaacgccacccgccagggcaatatcaagcgcaagctccttgcccttctgggcgcagag
aacggcgccaggacaaacggccgctcgccacaggccgcagcatag

DBGET integrated database retrieval system