KEGG   Brucella ovis: BOV_0489Help
Entry
BOV_0489          CDS       T00534                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bov  Brucella ovis
Pathway
bov00260  Glycine, serine and threonine metabolism
bov00750  Vitamin B6 metabolism
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01120  Microbial metabolism in diverse environments
bov01230  Biosynthesis of amino acids
Module
bov_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BOV_0489 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BOV_0489 (thrC)
Enzymes [BR:bov01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BOV_0489 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABQ60664
UniProt: A0A0H3AQV0
Position
I:complement(504609..506000)
Genome map
AA seq 463 aa AA seqDB search
MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT
PFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELFHGPTLAFKDVAMQLLA
RMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQMTSS
GFSNVHALSIEGNFDDCQNLVKGMFNDLEFRDALSLSGVNSINWARIMPQVVYYFTAALS
LGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTLESGAYEMRGV
AQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKPLSAIRSEFSA
GRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAREKASGTAPMVVLATAHPAKFPDAVK
AACGVEPQLPAWLCDLMQRKESFTVLHNELKIVEEYVRHHSRA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaagtacgcgtggggaagcaccggttctgggattcagcgatgcattgctc
gcaggcctcgcccgtgatggcggtctttatctgccgcaggaatatccgcaattcacagcc
gaacagatccgcgccctgcgtggaaaatcctatgtcgaagtcgcgctggccgtcctcacg
ccctttaccggcggtgaaattccggcagccgatttcgagcgcatggtccgcgaagcttac
ggaaccttccgtcacgatgccgtctgcccgttggtgcagaccgacgcgaacgaattcgtg
ctggagcttttccatggccccacccttgccttcaaggatgtcgccatgcagcttctggcc
cgcatgatggattatgttctggcacagcgcggcgagcgcgcaacgatcgtcggcgctaca
tccggcgatacgggcggcgcagccatcgaagcctttggcgggcgcgacaacacagacatt
ttcatcctgttccccaatgggcgggtctcgccggtacagcaacgccagatgacgtcttcc
ggcttttccaatgtccatgcgctttccatcgagggcaatttcgacgattgccagaacctc
gtaaaaggcatgttcaatgatctggaattccgtgacgccctgtcgctttccggcgtgaac
tcgatcaactgggcacgcatcatgccgcaggttgtctattatttcacggcagcactcagc
ctcggcgcaccggaccgcgccgtgtccttcacggtgcccaccggcaatttcggcgatatt
ttcgcaggctacgtcgccaagcgcatgggcctgcccatcgagcaactcatcatcgccacc
aacgacaacgatattctttcgcgcacgctggaaagcggggcctatgagatgcgcggcgta
gcgcagaccacttcgccctcaatggatatccagatttcctccaatttcgagcggcttctg
ttcgaggcacacgggcgcgatgcggcggccgtgcgcgggctgatgcagggcctgaagcaa
tctggcggatttacgatttccgaaaagccgctttcggccatccgcagcgaattttcggct
ggccgctccaccgtcgatgagacggcggcgactatcgaatcggttctttccaaagacggc
tatctgcttgatccgcattcggcgatcggtgtgaaggtcgcgcgtgaaaaagcatccggc
accgccccgatggtggttctggcgaccgcccatccggccaaattcccggatgcggtgaag
gctgcatgtggggtcgagccgcaattgccggcatggctttgcgacctgatgcaacgaaaa
gaaagcttcacagttcttcacaacgagctgaaaatcgtggaagaatatgtgcgccaccat
tcccgagcctga

DBGET integrated database retrieval system