KEGG   Brucella ovis: BOV_0844Help
Entry
BOV_0844          CDS       T00534                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bov  Brucella ovis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BOV_0844
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BOV_0844
  Lipid metabolism
   00071 Fatty acid degradation
    BOV_0844
  Amino acid metabolism
   00350 Tyrosine metabolism
    BOV_0844
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BOV_0844
   00626 Naphthalene degradation
    BOV_0844
Enzymes [BR:bov01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BOV_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(851002..852030)
Genome map
AA seq 342 aa AA seqDB search
MRALQLLDDRRLEITDIAPPPLPGMGEVTVRIKAVALNHIDVWGWRGMAFAKRKMPLVIG
AEASGVVDAVGPGASNLLPGQLVSIYGARTCGLCRACREGRDNLCEHVGGVHGFHLDGFA
CEAVNLPARLLVAAPPGVDAIGAAVAPVTFGTVEHMLFDNAKLEPGETVLVQAGGSGIGT
AAIQLAKKMGCTVITTVGSNDKIEKAKALGADHVINYREDRFEGVVRKLTKKKGVDVVFE
HVGADTWAGSMLCMKRGARLVTCGSTSGVSTNMNLMQLFQQQLKIFGSFGCRMENMADAM
QKMARGIVHPVIDTVVGFSDIDTALKRMEGRDVFGKIILQID
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccttgcagcttctcgatgatcgccgccttgaaatcaccgatattgcgcccccg
ccgctgcccggcatgggggaagtgaccgttcgcatcaaggccgtggcgctcaaccatatc
gatgtctggggctggcgcggcatggcctttgccaagcgcaagatgccgctcgtcatcggt
gcagaggcttccggtgttgtcgatgctgtcggtcccggcgcttccaatctcctgcccggc
cagctcgtttccatctatggcgcgcgcacctgcgggctttgccgcgcctgccgcgaaggc
cgtgacaatctttgcgaacatgtgggcggcgtgcatggtttccatcttgatggctttgcc
tgcgaagcggtgaaccttcccgcccgcctgctggttgccgcccctcccggcgtggatgct
atcggcgcggctgttgctccggtcacattcggcacggtggaacatatgctgttcgacaat
gccaagcttgaacccggcgaaaccgtgctcgttcaggctggcggctcaggcattggcacg
gctgcgatccagcttgcaaagaagatgggctgcacagtcatcaccacagtcggctccaac
gacaagatcgagaaggccaaggctcttggcgccgatcacgtcatcaattaccgcgaggac
cgtttcgagggcgtggtgcgcaagctcaccaagaagaagggcgtggatgtggtgttcgag
catgtgggcgcggacacatgggcaggctccatgctgtgcatgaagcgcggcgcgcgtctc
gtcacctgcggctcgacctcgggcgtttccacgaacatgaacctgatgcagcttttccag
cagcagttgaagattttcggctccttcggctgccgcatggaaaacatggccgacgccatg
cagaagatggcacgcggcatcgtgcatccggtcatcgacaccgtggttggctttagcgat
atcgacacggcgctgaagcgcatggaaggccgcgacgtcttcggcaagatcattctccag
atcgactga

DBGET integrated database retrieval system