KEGG   Brucella ovis: BOV_0878Help
Entry
BOV_0878          CDS       T00534                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bov  Brucella ovis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:885096..885764
Genome map
AA seq 222 aa AA seqDB search
MRQATSERPRLSDREGFASFVLRMRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRT
APLDCGEYMEGIDDQARVISALKLEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKL
CDHALQQFVSLKRENIMVKHTDGRHGMPGGPFDRIVIWLACDEVPRHFVELLATHGILIA
PIGPGDGRQIMTRISKVGSRFEQEDLMPVRYQPFIEGTSSVL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaggcaacgtctgaacgcccgcggctttcggaccgggagggatttgcatccttt
gttctgcggatgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagca
acgccgcgccagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaacc
gcgccgcttgattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttcc
gccctgaagcttgagcccggccatcgggttctggaaatcggcaccggctccggctttacc
gccgccgttatgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactc
tgcgaccacgctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacat
acagacgggcgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgca
tgcgatgaggtgccgcgccatttcgttgaactgctcgccacccatggcatcctgatagcc
ccgatcggccctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgt
tttgaacaggaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttcc
gttctttag

DBGET integrated database retrieval system