KEGG   Brucella ovis: BOV_0995Help
Entry
BOV_0995          CDS       T00534                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bov  Brucella ovis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bov00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1004796..1005635
Genome map
AA seq 279 aa AA seqDB search
MTKEWQLAHERSLHLGKTAIIMGVLNVTPDSFSDGGRYNDLDRAIAAAETMLEEGATIVD
VGGESTRPGATAVDAQTEASRVVPVIRELVRRFDCIISVDTYRASTARLAVEAGAHIVND
VWGLQREPEIAQLARETGAGLVIMHTSRDRLTNPDVIEDQFMFLNRSLKIAGDAGIEPSR
IVLDPGFGFGKERDEDIALMARMSELQAFGFPLLVGTSRKRFVGAMTGQADPRNRDIGTA
ATSVALRLAGADIFRVHNVAFNRDALAVADVILQSNVRI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagaatggcagcttgcccatgaacgcagcctccatctcggaaaaaccgccatc
attatgggagtactgaatgttacgccggattctttctcggatggcgggcgttataacgat
cttgatcgtgccatcgccgctgccgaaacgatgctggaggaaggcgcgaccattgtggac
gttgggggcgaatcgacgcgaccgggcgctactgctgtggatgcgcagacagaagccagc
cgtgtggttccggtaatccgggaactggtgaggcgcttcgattgtatcatttccgtggac
acttatcgtgcttctaccgcgcggcttgcggtggaggccggcgcgcatatcgtcaatgat
gtctgggggcttcagcgcgaaccggaaattgcccagcttgccagagaaacgggggcaggg
cttgtcatcatgcatacgagccgcgaccgcctcacgaatcccgacgtgatcgaagatcag
tttatgttcctgaacaggtcgctgaaaattgccggggatgcaggcatcgagccatcgcgc
atcgtgcttgatccgggtttcggcttcggcaaggagcgggatgaagacattgcgttgatg
gcgcgtatgtctgaattgcaggccttcggattccccctgctggtcggtacatcgcgcaag
cggttcgttggcgcaatgacggggcaggccgatccgcggaaccgcgatatcggcacagcg
gctacttccgtggcccttcgcctggcgggagccgacatcttccgtgttcacaatgtcgct
tttaacagagatgcacttgcagttgcggatgttatcctgcaaagcaacgtcaggatctaa

DBGET integrated database retrieval system