KEGG   Brucella ovis: BOV_1097Help
Entry
BOV_1097          CDS       T00534                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bov  Brucella ovis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BOV_1097 (tpiA)
   01230 Biosynthesis of amino acids
    BOV_1097 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BOV_1097 (tpiA)
   00051 Fructose and mannose metabolism
    BOV_1097 (tpiA)
   00562 Inositol phosphate metabolism
    BOV_1097 (tpiA)
Enzymes [BR:bov01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BOV_1097 (tpiA)
Exosome [BR:bov04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BOV_1097 (tpiA)
  Exosomal proteins of bladder cancer cells
   BOV_1097 (tpiA)
  Exosomal proteins of melanoma cells
   BOV_1097 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1118218..1118982)
Genome map
AA seq 254 aa AA seqDB search
MTPGIRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEG
ETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAA
WAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTP
TVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLK
AADFLAICETYRNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggaatccgtccgctggttgctggcaactggaaaatgaatggcaagggagaa
tccctgaccgaactgcgcgccatcgctgcgggcctcagctccgacctcggccgcaagctc
gatgcggtcatatgtgtgccggccaccttgctttcgcgtgcggctgaaacgctggaaggc
gaaacggtcggccttggcggacaggatgcccatttcaagacatccggcgcgcatacgggc
gacatttcgccggaaatgctcaaggaagctggtgccacccatgtcattctcggccattcc
gagcgccgcaccgatcatcacgagagcaataagctcatttgcgccaagacggaagccgca
tgggctgcggggctggtggctatcgtctgcgttggagaaaccgccagcgagcgaaaggcg
gagcgtgcgctcgatgtcattggcgaccagctttccggttcgctgccggatggggttacg
gcggaaaacacaatcattgcctatgaacccgtatgggctatcggcaccgggttgacgccg
acggttcaggatgttcgtgcagcgcacgccttcatgcgtgaacagttgatcgaacgtttc
ggcgcaaaaggcgcgcatctgcgccttctttatgggggttcggtgaagccgtccaatgct
gccgaattgctcggtgttgcagatgttgacggcgctcttgtcggcggcgcgagtttgaag
gcggcagacttcctcgccatatgcgaaacctatcgcaatctataa

DBGET integrated database retrieval system