KEGG   Brucella ovis: BOV_1393Help
Entry
BOV_1393          CDS       T00534                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bov  Brucella ovis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bov00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bov00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1402064..1403563)
Genome map
AA seq 499 aa AA seqDB search
MHATEPGFGMTMKLKEIALFNELAPGEAGEVEITGITSDSRAVQRGFLFAALKGVKADGA
VFAADAVKRGAVAIIAGKDTAIADAGVPVLHVDDPRHVLAIAAAQFYGKQPEVMVAVTGT
SGKTSVASFTRQIWAYAGFPAANIGTTGVFSPTRSDYNSLTTPDPVELHRVLAELASEGV
THAAMEASSHGLDQRRLDGVRLAAGAFTNLGRDHMDYHATIDEYLGAKMRLFNALLPKGA
PAIIFADDQFSAQAIEAATLAGCDVKTVGRKGNFIALKRVEHERFRQHVEVRIGEEIFEI
ELPLAGDFQVANALVAAGLAMVTGVPAAAAMRALALLKGAPGRLDLVGATEDGAPAYVDY
AHKPEALENVLTSVRPFTTGRVIVVFGCGGDRDKGKRPIMGEIASRLADVVIVTDDNPRS
EVPAQIRSEIMAAATGATEIGDRREAIFTAVSMMQPGDTLVVAGKGHEEGQIVGNITLPF
SDHAEVAAALAARLEEHPK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgcaactgaacctggatttggtatgaccatgaaactgaaggaaatcgctctcttt
aatgagctggcccccggcgaggccggtgaagtggaaattaccggcatcacttcggattcc
cgcgctgttcaacgcggttttctttttgcggcgctgaaaggcgtgaaagcggacggtgcg
gttttcgccgccgatgccgtaaagcgcggtgctgtcgccatcatcgcgggcaaggacacg
gccatcgctgatgcgggtgtgccggtgcttcatgtggatgatccgcgccatgttctcgcc
attgccgccgctcaattttatggcaagcagccggaagtcatggttgccgtgaccggcacc
agcggcaagacttccgttgcctccttcacgcgccagatctgggcctatgcggggtttccc
gcagccaatatcggcacgaccggcgtgttttcgccgacgcgcagcgactataattccttg
acgacgcccgacccggtggaactgcaccgcgttctggccgaacttgccagcgagggcgtg
acccatgcggcgatggaagcctcgtcgcacggtctggaccagcgtcgtctcgacggggtg
aggcttgctgcgggcgccttcaccaatcttggccgcgatcacatggattatcacgcgacc
attgatgaatatctgggcgcgaaaatgcgcctgttcaacgcgcttctgccgaagggtgcg
ccagccatcatctttgccgacgatcaattttcggcgcaggccatcgaagcggcgacgctt
gctggatgcgacgtgaagacggtcggtcgaaaaggcaatttcattgccctcaagcgcgtg
gaacacgagcgtttccgccagcatgtggaagtgcggatcggcgaggaaatctttgaaatc
gaattgccgctggcgggagattttcaggtcgccaatgcgctggttgcagcggggcttgcc
atggtgacgggcgttccggctgcggctgccatgcgtgcattggcacttctcaaaggcgca
ccgggacggcttgatcttgtcggtgcaacggaagatggtgcgccagcctatgttgattat
gcccataagccggaagcgttggaaaatgtgctgacctccgtgcgtccgtttacgacgggc
cgtgtgattgtggtctttggctgcggcggcgaccgcgacaagggcaagcgcccgatcatg
ggtgagattgcctcgcgtcttgccgatgtcgtgattgtcaccgacgacaatccccgttcg
gaagtgccagcacagatacgttccgaaatcatggcagcggcaacgggagcgacggaaatt
ggcgaccgacgcgaggcgatcttcaccgccgtttccatgatgcagcccggcgatacgctg
gtggttgcgggcaagggacatgaggaagggcagatcgtcggcaatattacgctgccgttt
tcagatcatgcagaagtggcggcggcacttgccgcccgtcttgaggagcatccaaaatga

DBGET integrated database retrieval system