KEGG   Brucella ovis: BOV_1542Help
Entry
BOV_1542          CDS       T00534                                 

Gene name
ctrA
Definition
(GenBank) cell cycle transcriptional regulator CtrA
  KO
K13584  two-component system, cell cycle response regulator CtrA
Organism
bov  Brucella ovis
Pathway
bov02020  Two-component system
Module
bov_M00512  CckA-CtrA/CpdR (cell cycle control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bov00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BOV_1542 (ctrA)
Two-component system [BR:bov02022]
 Cell cycle family
  CckA-CtrA/CpdR [MD:M00512]
   BOV_1542 (ctrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ABQ60383
UniProt: A5VRW9
Position
I:complement(1551062..1551760)
Genome map
AA seq 232 aa AA seqDB search
MRVLLIEDDSAIAQSIELMLKSESFNVYTTDLGEEGIDLGKLYDYDIILLDLNLPDMSGY
EVLRTLRLSKVKTPILILSGMAGIEDKVRGLGFGADDYMTKPFHKDELIARIHAIVRRSK
GHAQSVITTGDLVVNLDAKTVEVAGQRVHLTGKEYQMLELLSLRKGTTLTKEMFLNHLYG
GMDEPELKIIDVFICKLRKKLDAVSGNQSYIETVWGRGYVLREPDAEMRESA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtccttttgattgaagacgacagtgctatcgcacagagcattgagttgatgctc
aagtccgagagttttaatgtctatacgaccgatctgggcgaagaaggcatcgatctcggc
aagctttacgactacgacatcattctgctggatctcaatctgccggatatgtctggttat
gaagttcttcgcaccttgcgtctgtccaaggtgaagacgccgatccttatcctttccggc
atggccggcatcgaggacaaggttcgcggtcttggctttggcgccgacgattatatgact
aagccgttccataaggacgagctgattgcccgtatccatgcgatcgtccgccgctccaag
gggcatgcccagtcggtcatcacgacgggcgacctggtggtcaatctggatgccaagacg
gtggaagtcgcaggccagcgcgttcatctgaccggcaaggaataccagatgcttgagctg
ctttcgctgcgcaagggcacgacgctcaccaaggaaatgttcctgaaccatctttatggt
ggcatggatgagccggaattgaagatcatcgacgtcttcatctgcaagctgcgcaagaag
ctcgacgccgtttccggcaatcagagctatatcgaaaccgtctgggggcgtggttatgtg
ctgcgcgagccggatgccgagatgcgcgaaagcgcctga

DBGET integrated database retrieval system