KEGG   Brucella ovis: BOV_1744Help
Entry
BOV_1744          CDS       T00534                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bov  Brucella ovis
Pathway
bov00010  Glycolysis / Gluconeogenesis
bov00620  Pyruvate metabolism
bov00640  Propanoate metabolism
bov00680  Methane metabolism
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01120  Microbial metabolism in diverse environments
bov01130  Biosynthesis of antibiotics
bov01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BOV_1744 (acsA)
   00620 Pyruvate metabolism
    BOV_1744 (acsA)
   00640 Propanoate metabolism
    BOV_1744 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BOV_1744 (acsA)
Enzymes [BR:bov01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BOV_1744 (acsA)
Lipid biosynthesis proteins [BR:bov01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BOV_1744 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABQ61179
UniProt: A5VSF3
Position
I:1747617..1749572
Genome map
AA seq 651 aa AA seqDB search
MSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFWAKHGRRIDWFKPFTKVKNTDFN
GDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGDNPYIDKKITYRELYENVCRMAN
VLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTF
VITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDLWYHQE
VASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHDGEI
YWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTA
LRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGG
ILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQEGVADGNLCISDSWPGQMRTVYGD
HKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHH
SVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELRKELVQHVRKEIGPIATPDKIQF
APGLPKTRSGKIMRRILRKIAEDESGALGDTSTLADPGVVDDLIENRQNKK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaagctttaccccgtgctgccggaggcaaagaaaaacacgctcatcgacaac
gagacttatctcgaatggtatgaggagagcgtgagcgacccggatggcttctgggccaag
cacggccggcgtatcgactggttcaagcctttcaccaaggtcaagaacaccgatttcaac
ggcgatgtaacgatcaagtggtatgaggatggcgtcaccaacgtctcatataattgcatc
gaccgccatctgaagagccgcggcgacaaggtcgccatcatctgggaaggcgacaacccc
tatatcgacaagaagatcacctatcgcgagctttacgagaatgtctgccgcatggcgaat
gtgctcaagaagcatggggtgaagaagggcgaccgcgtcacgatctatctgccgatgatc
ccggaagccgcctatgccatgctcgcctgcgcgcgcatcggcgccgtgcactcggtcgtc
tttgccggtttctcgccggaggcgctcgctggccgcatcgttgactgcgaatccactttc
gtcatcaccgccgatgaaggtgtgcgcggcggcaagcctgttgcgctgaaggaaaacacc
gataccgccatcgacatcgccgccaagcaatatgtgatggtcaacaaggtgctggtcgtg
cgccgcaccggcggcaaggtaagctggggccgcggccgcgatctgtggtaccatcaggaa
gtcgcaagcgtcgaaccgcattgcgaaccggaaccgatgaatgcggaagacccgcttttc
attctctacacatccggttccaccggcaagccgaagggtgtgctgcataccaccggcggc
tacctcgtctatgcctcgatgacgcatcaatatgtcttcgattaccatgatggcgagatc
tactggtgcacggcggatgtgggttgggtaacgggccactcctatatcgtctacggaccg
ctggccaatggcgcgacaacgctgatgtttgaaggcgtgcccaacttccccgatcagggc
cgtttctgggaagtcgtcgacaagcaccatgtcaatatcttctacaccgcgccaaccgcg
ctgcgcgcgcttatgggcgcgggcgatgaattcgtaacccgctcatcgcgttcgacgctg
cgcctgctgggctcggtcggcgagccgatcaatccagaggcctgggagtggtattacaat
gtcgtgggcgaccagaaatgccccatcgtcgatacctggtggcagacggaaaatggcggc
atcctcatcaccccacttcccggcgcgaccgatttgaaacccggttcggcaacacgcccg
ttcttcggcgtcaagccggtgctggtggacaatgaaggcaatgtgcaggagggcgtagcc
gacggcaacctgtgcatctccgactcctggccgggccagatgcgcaccgtctatggcgac
cacaagcgtttcatcgaaacctacttctccacctataaggggatgtatttttcgggcgat
ggctgccgccgcgacgaggacggctattactggatcaccggccgcgtcgatgacgtgctg
aatatttccggccatcgcctcggcacggcggaaatcgaatcggcacttgtctcgcatcac
tcggtttcggaagccgccgtggtcggctatccgcacccgatcaagggacagggcatctat
tgctatgtcacgctgatgaccggcgcagacgcgcaggacccggacgagttgcgcaaggaa
ctggtccagcatgtgcgcaaggaaatcggccccatcgccacaccggacaagatccagttt
gcgcccggactgccgaaaacccgttccggcaagatcatgcgccgcatcctgcgcaagatc
gccgaagacgagtccggcgcattgggcgacacctcaacgctcgccgatccgggcgtggtg
gacgacctgatcgaaaatcgccagaacaagaaatga

DBGET integrated database retrieval system