KEGG   Brucella ovis: BOV_1851Help
Entry
BOV_1851          CDS       T00534                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bov  Brucella ovis
Pathway
bov00020  Citrate cycle (TCA cycle)
bov00310  Lysine degradation
bov01100  Metabolic pathways
bov01110  Biosynthesis of secondary metabolites
bov01120  Microbial metabolism in diverse environments
bov01130  Biosynthesis of antibiotics
bov01200  Carbon metabolism
Module
bov_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bov_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bov00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOV_1851 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BOV_1851 (sucB)
Enzymes [BR:bov01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BOV_1851 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2967 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABQ61099
UniProt: A0A0H3AR50
Position
I:complement(1857449..1858675)
Genome map
AA seq 408 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT
AKEGDTVEVGALLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQPAPA
AAKLLAESGLSADQVEGSGKRGQVLKGDVLDAITKGVSAAPAAPVAARPASSADDASREE
RVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVFEKKHGVKLGFMGF
FTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVVPVIRDADQMSIAEVEK
ELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAPQSGILGMHKIQERPMV
VGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaattcgcgttcccacgcttggggagtccgttaccgaggcaaccatcgga
aagtggttcaagaaggctggtgaagccattgctgtcgatgagccgctggtggaactggaa
accgacaaggtgacggtcgaagtgcccgcaccggctgcgggtgttctggccgaaatcacg
gccaaggaaggcgatacggtcgaagtgggcgcactgctcggccagatttccagtgacggg
gcagcggttgccgccgcaccggcccaaaagaaggaggaagccaagcctgcagccgccgct
cctgctgctgcaccggtcgcatcggcttcgtcgggcccggccatgcagccggcgccggct
gctgcgaagcttctggctgaaagcggtctttccgccgatcaggtcgaaggttccggcaag
cgcggccaggtgctcaaaggtgacgttctcgacgccatcacgaaaggcgtttcggcggct
cctgccgctccggttgccgcgcgtccggcctcctcggctgatgacgcatcgcgcgaagag
cgtgtgaagatgacccgtctgcgccagaccattgcgcgccgcctgaaggatgcccagaac
acggctgccatgctcaccaccttcaacgaggtggacatgtcggcagtcatggagctgcgt
aacaagtataaggacgtctttgaaaagaagcatggcgtgaagcttggcttcatgggcttc
ttcaccaaggcagtgacgcatgcgctgaaggaaatcccggctgtcaacgccgagatcgac
ggcacggacatcgtctacaagaacttctgccatgtcggcatggctgtcggcaccgacaag
ggcctcgtcgttccggtcatccgcgatgccgaccagatgtcgattgcggaagtggaaaag
gaactggcacgtctcgccagggctgcgcgtgacggctcgctttccatggccgatatgcag
ggcggcacctttaccatcaccaatggcggtgtttacggttcgctcatgtccacgccgatc
ctcaatgcgccgcagtcgggcattctcggtatgcacaagatccaggaacgcccgatggtc
gtcggtggccagatcgtggtccgcccgatgatgtatctggcgctttcctacgatcaccgc
atcgtggacggcaaggaagccgtgaccttcctcgtgcgtgtgaaggaaagcctggaagat
ccggaacgtctggttctcgatctctag

DBGET integrated database retrieval system